Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
Location | 828549..828961 | Replicon | chromosome |
Accession | NZ_CP082772 | ||
Organism | Escherichia coli O2:H1 strain HM670 |
Toxin (Protein)
Gene name | symE | Uniprot ID | Q8FA88 |
Locus tag | K8B93_RS03855 | Protein ID | WP_000132630.1 |
Coordinates | 828549..828890 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 828885..828961 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K8B93_RS03830 (823618) | 823618..824898 | - | 1281 | WP_001304526.1 | DUF445 domain-containing protein | - |
K8B93_RS03835 (825083) | 825083..826003 | + | 921 | WP_000181195.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
K8B93_RS03840 (826231) | 826231..826311 | + | 81 | WP_020233658.1 | hypothetical protein | - |
K8B93_RS03845 (826409) | 826409..827291 | + | 883 | Protein_736 | DUF262 domain-containing protein | - |
K8B93_RS03850 (827339) | 827339..828502 | + | 1164 | WP_072202028.1 | DUF1524 domain-containing protein | - |
K8B93_RS03855 (828549) | 828549..828890 | - | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
- (828885) | 828885..828961 | + | 77 | NuclAT_7 | - | Antitoxin |
- (828885) | 828885..828961 | + | 77 | NuclAT_7 | - | Antitoxin |
- (828885) | 828885..828961 | + | 77 | NuclAT_7 | - | Antitoxin |
- (828885) | 828885..828961 | + | 77 | NuclAT_7 | - | Antitoxin |
- (828885) | 828885..828961 | + | 77 | NuclAT_8 | - | Antitoxin |
- (828885) | 828885..828961 | + | 77 | NuclAT_8 | - | Antitoxin |
- (828885) | 828885..828961 | + | 77 | NuclAT_8 | - | Antitoxin |
- (828885) | 828885..828961 | + | 77 | NuclAT_8 | - | Antitoxin |
K8B93_RS03860 (829111) | 829111..830880 | - | 1770 | WP_000110076.1 | restriction endonuclease subunit S | - |
K8B93_RS03865 (830880) | 830880..832349 | - | 1470 | WP_001315223.1 | type I restriction-modification system subunit M | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T214857 WP_000132630.1 NZ_CP082772:c828890-828549 [Escherichia coli O2:H1]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
>T214857 NZ_CP110289:2730004-2730144 [Enterococcus faecalis]
ATTTCTCTGAAAAATACGAATAAAAATATCGTTTACTGTACAACATATGAAACAATTCAGACGATCCTAGGGTTTGGTAT
GTTTACCATTGCTTTGATTGCACTGATTGTGAAATTGCTTAAAAATGACAAGAAAAAATAA
ATTTCTCTGAAAAATACGAATAAAAATATCGTTTACTGTACAACATATGAAACAATTCAGACGATCCTAGGGTTTGGTAT
GTTTACCATTGCTTTGATTGCACTGATTGTGAAATTGCTTAAAAATGACAAGAAAAAATAA
Antitoxin
Download Length: 77 bp
>AT214857 NZ_CP082772:828885-828961 [Escherichia coli O2:H1]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|