Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2555430..2555614 | Replicon | chromosome |
| Accession | NC_007793 | ||
| Organism | Staphylococcus aureus subsp. aureus USA300 FPR3757 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | Q2FVI9 |
| Locus tag | SAUSA300_RS13140 | Protein ID | WP_000482650.1 |
| Coordinates | 2555507..2555614 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2555430..2555490 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAUSA300_RS13115 | 2550960..2551127 | - | 168 | WP_001790576.1 | hypothetical protein | - |
| SAUSA300_RS13125 | 2551358..2553091 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
| SAUSA300_RS13130 | 2553116..2554879 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2555430..2555490 | + | 61 | - | - | Antitoxin |
| SAUSA300_RS13140 | 2555507..2555614 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| SAUSA300_RS13145 | 2555748..2556134 | - | 387 | WP_000779358.1 | flippase GtxA | - |
| SAUSA300_RS13150 | 2556402..2557544 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| SAUSA300_RS13155 | 2557604..2558263 | + | 660 | WP_000831298.1 | membrane protein | - |
| SAUSA300_RS13160 | 2558445..2559656 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| SAUSA300_RS13165 | 2559779..2560252 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T21478 WP_000482650.1 NC_007793:c2555614-2555507 [Staphylococcus aureus subsp. aureus USA300_FPR3757]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T21478 NC_007793:c2555614-2555507 [Staphylococcus aureus subsp. aureus USA300_FPR3757]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT21478 NC_007793:2555430-2555490 [Staphylococcus aureus subsp. aureus USA300_FPR3757]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|