Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 41196..41465 | Replicon | plasmid pVCSW7 |
| Accession | NZ_CP082358 | ||
| Organism | Escherichia coli strain VCSW7 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | K7X31_RS22585 | Protein ID | WP_001372321.1 |
| Coordinates | 41340..41465 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 41196..41261 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K7X31_RS22995 | 36240..36491 | + | 252 | WP_071828952.1 | hypothetical protein | - |
| K7X31_RS23000 | 36732..36938 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| K7X31_RS22555 | 36964..37503 | + | 540 | WP_105633039.1 | single-stranded DNA-binding protein | - |
| K7X31_RS22560 | 37565..37798 | + | 234 | WP_105633040.1 | DUF905 family protein | - |
| K7X31_RS22565 | 37864..39822 | + | 1959 | WP_223025133.1 | ParB/RepB/Spo0J family partition protein | - |
| K7X31_RS22570 | 39877..40311 | + | 435 | WP_105633042.1 | conjugation system SOS inhibitor PsiB | - |
| K7X31_RS22575 | 40308..41070 | + | 763 | Protein_45 | plasmid SOS inhibition protein A | - |
| K7X31_RS22580 | 41039..41227 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 41039..41263 | + | 225 | NuclAT_0 | - | - |
| - | 41039..41263 | + | 225 | NuclAT_0 | - | - |
| - | 41039..41263 | + | 225 | NuclAT_0 | - | - |
| - | 41039..41263 | + | 225 | NuclAT_0 | - | - |
| - | 41196..41261 | - | 66 | - | - | Antitoxin |
| K7X31_RS23005 | 41249..41398 | + | 150 | Protein_47 | plasmid maintenance protein Mok | - |
| K7X31_RS22585 | 41340..41465 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| K7X31_RS23010 | 41686..41916 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| K7X31_RS23015 | 41914..42087 | - | 174 | Protein_50 | hypothetical protein | - |
| K7X31_RS23020 | 42157..42363 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| K7X31_RS22590 | 42388..42675 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| K7X31_RS22595 | 42759..43955 | - | 1197 | WP_001358663.1 | IS110-like element ISEc20 family transposase | - |
| K7X31_RS22600 | 44248..45069 | + | 822 | WP_143189711.1 | DUF932 domain-containing protein | - |
| K7X31_RS22605 | 45366..45956 | - | 591 | WP_165850686.1 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | faeC / faeD / faeE / faeF / faeH / faeI / faeJ | 1..89947 | 89947 | |
| - | flank | IS/Tn | - | - | 42759..43955 | 1196 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T214720 WP_001372321.1 NZ_CP082358:41340-41465 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T214720 NZ_CP110198:364861-365136 [Salmonella enterica subsp. enterica serovar Typhimurium]
ATGGGGCAAAGGGAAATTGAATATTCGGGACAGTTCCAGAAAGATGTAAAACGGGCACAAAAGCGTCATAAGGATGTCGG
CAAACTTAAAACACTTATGACGCTTCTGATTCACCACCCTTTTCCCCTTCCTGCCATTTATAAAGATCACCCGTTACAAG
GTTCATATAGCGGATACCGGGATGCCCATATTGAGCCTGACTGGATTCTTATTTATAAGATAACGGATGAATGCCTGCGA
TTTGAACGAACAGGAACGCATGCCGATTTATTTTAA
ATGGGGCAAAGGGAAATTGAATATTCGGGACAGTTCCAGAAAGATGTAAAACGGGCACAAAAGCGTCATAAGGATGTCGG
CAAACTTAAAACACTTATGACGCTTCTGATTCACCACCCTTTTCCCCTTCCTGCCATTTATAAAGATCACCCGTTACAAG
GTTCATATAGCGGATACCGGGATGCCCATATTGAGCCTGACTGGATTCTTATTTATAAGATAACGGATGAATGCCTGCGA
TTTGAACGAACAGGAACGCATGCCGATTTATTTTAA
Antitoxin
Download Length: 66 bp
>AT214720 NZ_CP082358:c41261-41196 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|