Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2090217..2090516 | Replicon | chromosome |
| Accession | NC_007793 | ||
| Organism | Staphylococcus aureus subsp. aureus USA300 FPR3757 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | SAUSA300_RS15490 | Protein ID | WP_011447039.1 |
| Coordinates | 2090340..2090516 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2090217..2090272 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAUSA300_RS10520 | 2085548..2085808 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| SAUSA300_RS10525 | 2085861..2086211 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| SAUSA300_RS10530 | 2086896..2087345 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| SAUSA300_RS15815 | 2087440..2087775 | - | 336 | Protein_2002 | SH3 domain-containing protein | - |
| SAUSA300_RS10540 | 2088425..2088916 | - | 492 | WP_000919350.1 | staphylokinase | - |
| SAUSA300_RS10545 | 2089107..2089862 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SAUSA300_RS10550 | 2089874..2090128 | - | 255 | WP_000611512.1 | phage holin | - |
| SAUSA300_RS10555 | 2090180..2090287 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2090209..2090348 | + | 140 | NuclAT_0 | - | - |
| - | 2090209..2090348 | + | 140 | NuclAT_0 | - | - |
| - | 2090209..2090348 | + | 140 | NuclAT_0 | - | - |
| - | 2090209..2090348 | + | 140 | NuclAT_0 | - | - |
| - | 2090217..2090272 | + | 56 | - | - | Antitoxin |
| SAUSA300_RS15490 | 2090340..2090516 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| SAUSA300_RS10565 | 2090666..2090962 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| SAUSA300_RS10570 | 2091020..2091307 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| SAUSA300_RS10575 | 2091354..2091506 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| SAUSA300_RS10580 | 2091496..2095281 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2085861..2144829 | 58968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T21469 WP_011447039.1 NC_007793:c2090516-2090340 [Staphylococcus aureus subsp. aureus USA300_FPR3757]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T21469 NC_007793:c2090516-2090340 [Staphylococcus aureus subsp. aureus USA300_FPR3757]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT21469 NC_007793:2090217-2090272 [Staphylococcus aureus subsp. aureus USA300_FPR3757]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|