Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2705261..2705481 Replicon chromosome
Accession NZ_CP082349
Organism Escherichia coli strain AL.H8

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag K7H97_RS13285 Protein ID WP_000170965.1
Coordinates 2705374..2705481 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2705261..2705327 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K7H97_RS13255 2701053..2701406 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
K7H97_RS13260 2701450..2702145 - 696 WP_001351485.1 glutathione-specific gamma-glutamylcyclotransferase -
K7H97_RS13265 2702303..2702533 - 231 WP_001146442.1 putative cation transport regulator ChaB -
K7H97_RS13270 2702803..2703378 + 576 Protein_2602 sodium-potassium/proton antiporter ChaA -
K7H97_RS13275 2703412..2704380 + 969 WP_000654812.1 IS5-like element IS903B family transposase -
K7H97_RS13280 2704439..2704969 + 531 Protein_2604 sodium-potassium/proton antiporter ChaA -
- 2705261..2705327 - 67 - - Antitoxin
K7H97_RS13285 2705374..2705481 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2705794..2705857 - 64 NuclAT_33 - -
- 2705794..2705857 - 64 NuclAT_33 - -
- 2705794..2705857 - 64 NuclAT_33 - -
- 2705794..2705857 - 64 NuclAT_33 - -
- 2705794..2705857 - 64 NuclAT_35 - -
- 2705794..2705857 - 64 NuclAT_35 - -
- 2705794..2705857 - 64 NuclAT_35 - -
- 2705794..2705857 - 64 NuclAT_35 - -
- 2705794..2705857 - 64 NuclAT_37 - -
- 2705794..2705857 - 64 NuclAT_37 - -
- 2705794..2705857 - 64 NuclAT_37 - -
- 2705794..2705857 - 64 NuclAT_37 - -
- 2705794..2705857 - 64 NuclAT_39 - -
- 2705794..2705857 - 64 NuclAT_39 - -
- 2705794..2705857 - 64 NuclAT_39 - -
- 2705794..2705857 - 64 NuclAT_39 - -
- 2705794..2705857 - 64 NuclAT_41 - -
- 2705794..2705857 - 64 NuclAT_41 - -
- 2705794..2705857 - 64 NuclAT_41 - -
- 2705794..2705857 - 64 NuclAT_41 - -
- 2705794..2705857 - 64 NuclAT_43 - -
- 2705794..2705857 - 64 NuclAT_43 - -
- 2705794..2705857 - 64 NuclAT_43 - -
- 2705794..2705857 - 64 NuclAT_43 - -
- 2705795..2705857 - 63 NuclAT_45 - -
- 2705795..2705857 - 63 NuclAT_45 - -
- 2705795..2705857 - 63 NuclAT_45 - -
- 2705795..2705857 - 63 NuclAT_45 - -
- 2705795..2705857 - 63 NuclAT_48 - -
- 2705795..2705857 - 63 NuclAT_48 - -
- 2705795..2705857 - 63 NuclAT_48 - -
- 2705795..2705857 - 63 NuclAT_48 - -
- 2705795..2705857 - 63 NuclAT_51 - -
- 2705795..2705857 - 63 NuclAT_51 - -
- 2705795..2705857 - 63 NuclAT_51 - -
- 2705795..2705857 - 63 NuclAT_51 - -
- 2705796..2705857 - 62 NuclAT_15 - -
- 2705796..2705857 - 62 NuclAT_15 - -
- 2705796..2705857 - 62 NuclAT_15 - -
- 2705796..2705857 - 62 NuclAT_15 - -
- 2705796..2705857 - 62 NuclAT_18 - -
- 2705796..2705857 - 62 NuclAT_18 - -
- 2705796..2705857 - 62 NuclAT_18 - -
- 2705796..2705857 - 62 NuclAT_18 - -
- 2705796..2705857 - 62 NuclAT_21 - -
- 2705796..2705857 - 62 NuclAT_21 - -
- 2705796..2705857 - 62 NuclAT_21 - -
- 2705796..2705857 - 62 NuclAT_21 - -
- 2705796..2705857 - 62 NuclAT_24 - -
- 2705796..2705857 - 62 NuclAT_24 - -
- 2705796..2705857 - 62 NuclAT_24 - -
- 2705796..2705857 - 62 NuclAT_24 - -
- 2705796..2705857 - 62 NuclAT_27 - -
- 2705796..2705857 - 62 NuclAT_27 - -
- 2705796..2705857 - 62 NuclAT_27 - -
- 2705796..2705857 - 62 NuclAT_27 - -
- 2705796..2705857 - 62 NuclAT_30 - -
- 2705796..2705857 - 62 NuclAT_30 - -
- 2705796..2705857 - 62 NuclAT_30 - -
- 2705796..2705857 - 62 NuclAT_30 - -
K7H97_RS13290 2705910..2706017 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2706331..2706397 - 67 NuclAT_44 - -
- 2706331..2706397 - 67 NuclAT_44 - -
- 2706331..2706397 - 67 NuclAT_44 - -
- 2706331..2706397 - 67 NuclAT_44 - -
- 2706331..2706397 - 67 NuclAT_47 - -
- 2706331..2706397 - 67 NuclAT_47 - -
- 2706331..2706397 - 67 NuclAT_47 - -
- 2706331..2706397 - 67 NuclAT_47 - -
- 2706331..2706397 - 67 NuclAT_50 - -
- 2706331..2706397 - 67 NuclAT_50 - -
- 2706331..2706397 - 67 NuclAT_50 - -
- 2706331..2706397 - 67 NuclAT_50 - -
- 2706332..2706395 - 64 NuclAT_16 - -
- 2706332..2706395 - 64 NuclAT_16 - -
- 2706332..2706395 - 64 NuclAT_16 - -
- 2706332..2706395 - 64 NuclAT_16 - -
- 2706332..2706395 - 64 NuclAT_19 - -
- 2706332..2706395 - 64 NuclAT_19 - -
- 2706332..2706395 - 64 NuclAT_19 - -
- 2706332..2706395 - 64 NuclAT_19 - -
- 2706332..2706395 - 64 NuclAT_22 - -
- 2706332..2706395 - 64 NuclAT_22 - -
- 2706332..2706395 - 64 NuclAT_22 - -
- 2706332..2706395 - 64 NuclAT_22 - -
- 2706332..2706395 - 64 NuclAT_25 - -
- 2706332..2706395 - 64 NuclAT_25 - -
- 2706332..2706395 - 64 NuclAT_25 - -
- 2706332..2706395 - 64 NuclAT_25 - -
- 2706332..2706395 - 64 NuclAT_28 - -
- 2706332..2706395 - 64 NuclAT_28 - -
- 2706332..2706395 - 64 NuclAT_28 - -
- 2706332..2706395 - 64 NuclAT_28 - -
- 2706332..2706395 - 64 NuclAT_31 - -
- 2706332..2706395 - 64 NuclAT_31 - -
- 2706332..2706395 - 64 NuclAT_31 - -
- 2706332..2706395 - 64 NuclAT_31 - -
K7H97_RS13295 2706445..2706552 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
K7H97_RS13300 2706701..2707555 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
K7H97_RS13305 2707591..2708400 - 810 WP_001257044.1 invasion regulator SirB1 -
K7H97_RS13310 2708404..2708796 - 393 WP_000200374.1 invasion regulator SirB2 -
K7H97_RS13315 2708793..2709626 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2703457..2704380 923


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T214653 WP_000170965.1 NZ_CP082349:2705374-2705481 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T214653 NZ_CP110162:c59261-58845 [Klebsiella pneumoniae]
ATGAAGAAAACCTGGATGCTCGACACCAACATCTGCTCGTTCATCATGCGCGAGCAGCCGGCAGCGGTGCTGAAGCGCCT
GGAGCAGGCGGTGCTGCGCGGTGATCGCATTGTGGTCTCGGCCGTGACGTATGCCGAGATGCGCTTCGGCGCCACCGGCC
CGAAGGCCTCGCCGCGCCATATTCAGCTGGTCGACGCGTTCTGCGCGCGCCTCGATGCCGTCCTGCCCTGGGACCGCGCC
GCGGTGGACGCCACGACGGACATCCGGGTGGCGCTGCGCCTAGCCGGGACGCCGATCGGCCCGAATGACACGGCCATTGC
CGGGCACGCCATCGCGGCGGGCGCCATCCTGGTGACGAACAATGTGAGAGAGTTTGCGCGGGTCCCGGGCCTGGTGCTGG
AAGACTGGGTGAAATAA

Antitoxin


Download         Length: 67 bp

>AT214653 NZ_CP082349:c2705327-2705261 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References