Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 87342..87950 | Replicon | chromosome |
Accession | NZ_CP082238 | ||
Organism | Acidithiobacillus ferrooxidans strain BYM |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2W1K1W3 |
Locus tag | K7B00_RS00440 | Protein ID | WP_012535782.1 |
Coordinates | 87342..87617 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | K7B00_RS00445 | Protein ID | WP_009566298.1 |
Coordinates | 87633..87950 (+) | Length | 106 a.a. |
Genomic Context
Location: 83120..84160 (1041 bp)
Type: Others
Protein ID: WP_012535779.1
Type: Others
Protein ID: WP_012535779.1
Location: 84228..85154 (927 bp)
Type: Others
Protein ID: WP_012535780.1
Type: Others
Protein ID: WP_012535780.1
Location: 85147..85515 (369 bp)
Type: Others
Protein ID: WP_012535781.1
Type: Others
Protein ID: WP_012535781.1
Location: 86255..86476 (222 bp)
Type: Others
Protein ID: WP_009566302.1
Type: Others
Protein ID: WP_009566302.1
Location: 86476..86889 (414 bp)
Type: Others
Protein ID: WP_009566301.1
Type: Others
Protein ID: WP_009566301.1
Location: 86886..87176 (291 bp)
Type: Others
Protein ID: WP_009566300.1
Type: Others
Protein ID: WP_009566300.1
Location: 87342..87617 (276 bp)
Type: Toxin
Protein ID: WP_012535782.1
Type: Toxin
Protein ID: WP_012535782.1
Location: 87633..87950 (318 bp)
Type: Antitoxin
Protein ID: WP_009566298.1
Type: Antitoxin
Protein ID: WP_009566298.1
Location: 87965..88144 (180 bp)
Type: Others
Protein ID: WP_009566297.1
Type: Others
Protein ID: WP_009566297.1
Location: 88564..89727 (1164 bp)
Type: Others
Protein ID: WP_009566294.1
Type: Others
Protein ID: WP_009566294.1
Location: 90024..90290 (267 bp)
Type: Others
Protein ID: WP_196491178.1
Type: Others
Protein ID: WP_196491178.1
Location: 90287..90529 (243 bp)
Type: Others
Protein ID: WP_012535785.1
Type: Others
Protein ID: WP_012535785.1
Location: 90613..90786 (174 bp)
Type: Others
Protein ID: WP_009562770.1
Type: Others
Protein ID: WP_009562770.1
Location: 90897..91325 (429 bp)
Type: Others
Protein ID: WP_009562768.1
Type: Others
Protein ID: WP_009562768.1
Location: 91328..91759 (432 bp)
Type: Others
Protein ID: WP_009562767.1
Type: Others
Protein ID: WP_009562767.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K7B00_RS00405 (K7B00_00405) | 83120..84160 | + | 1041 | WP_012535779.1 | glycosyltransferase family 1 protein | - |
K7B00_RS00410 (K7B00_00410) | 84228..85154 | + | 927 | WP_012535780.1 | glycosyltransferase | - |
K7B00_RS00415 (K7B00_00415) | 85147..85515 | + | 369 | WP_012535781.1 | glycosyltransferase | - |
K7B00_RS00425 (K7B00_00425) | 86255..86476 | + | 222 | WP_009566302.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
K7B00_RS00430 (K7B00_00430) | 86476..86889 | + | 414 | WP_009566301.1 | type II toxin-antitoxin system VapC family toxin | - |
K7B00_RS00435 (K7B00_00435) | 86886..87176 | + | 291 | WP_009566300.1 | hypothetical protein | - |
K7B00_RS00440 (K7B00_00440) | 87342..87617 | + | 276 | WP_012535782.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K7B00_RS00445 (K7B00_00445) | 87633..87950 | + | 318 | WP_009566298.1 | HigA family addiction module antitoxin | Antitoxin |
K7B00_RS00450 (K7B00_00450) | 87965..88144 | + | 180 | WP_009566297.1 | HNH endonuclease | - |
K7B00_RS00455 (K7B00_00455) | 88564..89727 | + | 1164 | WP_009566294.1 | Fic family protein | - |
K7B00_RS00460 (K7B00_00460) | 90024..90290 | - | 267 | WP_196491178.1 | hypothetical protein | - |
K7B00_RS00465 (K7B00_00465) | 90287..90529 | - | 243 | WP_012535785.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
K7B00_RS00470 (K7B00_00470) | 90613..90786 | - | 174 | WP_009562770.1 | PCP reductase family protein | - |
K7B00_RS00475 (K7B00_00475) | 90897..91325 | - | 429 | WP_009562768.1 | hypothetical protein | - |
K7B00_RS00480 (K7B00_00480) | 91328..91759 | - | 432 | WP_009562767.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10433.84 Da Isoelectric Point: 7.9070
>T214437 WP_012535782.1 NZ_CP082238:87342-87617 [Acidithiobacillus ferrooxidans]
MIRSFVHKGLKQVFETGQSAKVGADLVTRCKRRLDAINAATSPEELNVPGFDFHALEGKPKRYTVHVNGPYCITFEWREG
DAWRIDLENYH
MIRSFVHKGLKQVFETGQSAKVGADLVTRCKRRLDAINAATSPEELNVPGFDFHALEGKPKRYTVHVNGPYCITFEWREG
DAWRIDLENYH
Download Length: 276 bp
>T214437 NZ_CP110074:571113-571229 [Enterococcus faecalis]
ATGTTGTTGTCCGTTGAAGCAGCGCTAGGACTGATGATTAGTTTTGCAATACTTGTTGTGACCATTATCTTCGGTATCTT
AGCGCTTGTCTTAGACAACAAAAATAACCGTTCATAA
ATGTTGTTGTCCGTTGAAGCAGCGCTAGGACTGATGATTAGTTTTGCAATACTTGTTGTGACCATTATCTTCGGTATCTT
AGCGCTTGTCTTAGACAACAAAAATAACCGTTCATAA
Antitoxin
Download Length: 106 a.a. Molecular weight: 11756.54 Da Isoelectric Point: 5.6631
>AT214437 WP_009566298.1 NZ_CP082238:87633-87950 [Acidithiobacillus ferrooxidans]
MDEMTVEQVDRIPTHPGEILREEVLPALDISVAEFARGLRVSRQTVHGILSERKGITPEMALRIGKYLGNGPGIWLRMQQ
AYDLTVAERRLAEELAAIHKPEQAA
MDEMTVEQVDRIPTHPGEILREEVLPALDISVAEFARGLRVSRQTVHGILSERKGITPEMALRIGKYLGNGPGIWLRMQQ
AYDLTVAERRLAEELAAIHKPEQAA
Download Length: 318 bp
>AT214437 NZ_CP110074:c571345-571140 [Enterococcus faecalis]
AAAAGAGAGATATGCAGGAACATACCTCTCTAATAGCCACTACTAGTTATAAGAACTAGCGGCTTACTGAGTTATTGGTT
TTATTTCAAACGCTTAACCGTTCAGCTCCTCAAAGCTTATGAACGGTTATTTTTGTTGTCTAAGACAAGCGCTAAGATAC
CGAAGATAATGGTCACAACAAGTATTGCAAAACTAATCATCAGTCC
AAAAGAGAGATATGCAGGAACATACCTCTCTAATAGCCACTACTAGTTATAAGAACTAGCGGCTTACTGAGTTATTGGTT
TTATTTCAAACGCTTAACCGTTCAGCTCCTCAAAGCTTATGAACGGTTATTTTTGTTGTCTAAGACAAGCGCTAAGATAC
CGAAGATAATGGTCACAACAAGTATTGCAAAACTAATCATCAGTCC
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W1K1W3 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |