Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 326774..326968 | Replicon | chromosome |
Accession | NZ_CP082231 | ||
Organism | Enterococcus faecalis strain E006 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | K4200_RS01650 | Protein ID | WP_015543884.1 |
Coordinates | 326873..326968 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 326774..326838 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K4200_RS01635 | 322405..324147 | + | 1743 | WP_070416039.1 | PTS transporter subunit EIIC | - |
K4200_RS01640 | 324138..326171 | + | 2034 | WP_016626080.1 | BglG family transcription antiterminator | - |
K4200_RS01645 | 326182..326616 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 326774..326838 | + | 65 | - | - | Antitoxin |
K4200_RS01650 | 326873..326968 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
K4200_RS01655 | 327214..328986 | + | 1773 | WP_023894889.1 | PTS mannitol-specific transporter subunit IIBC | - |
K4200_RS01660 | 329001..329438 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
K4200_RS01665 | 329453..330607 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
K4200_RS01670 | 330676..331791 | - | 1116 | WP_002361174.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T214399 WP_015543884.1 NZ_CP082231:c326968-326873 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T214399 NZ_CP110068:c329489-329394 [Enterococcus faecalis]
ATGTACGACATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGACATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT214399 NZ_CP082231:326774-326838 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|