Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 82163..82416 | Replicon | plasmid pKP18-2073-KPC2 |
Accession | NZ_CP082025 | ||
Organism | Klebsiella pneumoniae strain KP18-2073 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | K6166_RS28390 | Protein ID | WP_001312851.1 |
Coordinates | 82163..82312 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 82357..82416 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6166_RS28355 (77522) | 77522..77937 | - | 416 | Protein_107 | IS1-like element IS1B family transposase | - |
K6166_RS28360 (78186) | 78186..78587 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
K6166_RS28365 (78520) | 78520..78777 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
K6166_RS28370 (78870) | 78870..79523 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
K6166_RS28375 (80462) | 80462..81319 | - | 858 | WP_142295464.1 | incFII family plasmid replication initiator RepA | - |
K6166_RS30230 (81338) | 81338..81516 | - | 179 | Protein_112 | protein CopA/IncA | - |
K6166_RS28385 (81631) | 81631..81879 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
K6166_RS28390 (82163) | 82163..82312 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
- (82357) | 82357..82416 | + | 60 | NuclAT_1 | - | Antitoxin |
- (82357) | 82357..82416 | + | 60 | NuclAT_1 | - | Antitoxin |
- (82357) | 82357..82416 | + | 60 | NuclAT_1 | - | Antitoxin |
- (82357) | 82357..82416 | + | 60 | NuclAT_1 | - | Antitoxin |
K6166_RS28395 (82617) | 82617..82949 | - | 333 | WP_152916585.1 | hypothetical protein | - |
K6166_RS28400 (83011) | 83011..83610 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
K6166_RS28405 (83996) | 83996..84196 | - | 201 | WP_015059022.1 | hypothetical protein | - |
K6166_RS28410 (84328) | 84328..84888 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
K6166_RS28415 (84943) | 84943..85689 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
K6166_RS28420 (85709) | 85709..85909 | - | 201 | WP_072354025.1 | hypothetical protein | - |
K6166_RS28425 (85934) | 85934..86638 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
K6166_RS28430 (86691) | 86691..86756 | + | 66 | Protein_122 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaSHV-187 / blaKPC-2 | - | 1..130597 | 130597 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T213997 WP_001312851.1 NZ_CP082025:c82312-82163 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T213997 NZ_CP109933:20010-20186 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 60 bp
>AT213997 NZ_CP082025:82357-82416 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|