Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 57859..58128 | Replicon | plasmid pKP18-238-KPC2 |
| Accession | NZ_CP082015 | ||
| Organism | Klebsiella pneumoniae strain KP18-238 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | K6162_RS28080 | Protein ID | WP_001372321.1 |
| Coordinates | 58003..58128 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 57859..57924 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K6162_RS28055 | 53569..54096 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| K6162_RS28060 | 54154..54387 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| K6162_RS28065 | 54448..56471 | + | 2024 | Protein_76 | ParB/RepB/Spo0J family partition protein | - |
| K6162_RS28070 | 56540..56974 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| K6162_RS28075 | 56971..57690 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 57702..57926 | + | 225 | NuclAT_0 | - | - |
| - | 57702..57926 | + | 225 | NuclAT_0 | - | - |
| - | 57702..57926 | + | 225 | NuclAT_0 | - | - |
| - | 57702..57926 | + | 225 | NuclAT_0 | - | - |
| - | 57859..57924 | - | 66 | - | - | Antitoxin |
| K6162_RS29430 | 57912..58061 | + | 150 | Protein_79 | plasmid maintenance protein Mok | - |
| K6162_RS28080 | 58003..58128 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| K6162_RS28085 | 58447..58743 | - | 297 | Protein_81 | hypothetical protein | - |
| K6162_RS28090 | 59043..59339 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| K6162_RS28095 | 59450..60271 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| K6162_RS28100 | 60568..61215 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| K6162_RS28105 | 61492..61875 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| K6162_RS28110 | 62066..62752 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| K6162_RS28115 | 62846..63073 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | catA2 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..128480 | 128480 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T213936 WP_001372321.1 NZ_CP082015:58003-58128 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T213936 NZ_CP109921:c4394875-4394702 [Escherichia coli O2:K2:H1]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTCTTCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTCTTCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 66 bp
>AT213936 NZ_CP082015:c57924-57859 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|