Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 20593..20846 | Replicon | plasmid pKP18-238-KPC2 |
Accession | NZ_CP082015 | ||
Organism | Klebsiella pneumoniae strain KP18-238 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | K6162_RS27840 | Protein ID | WP_001312851.1 |
Coordinates | 20697..20846 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 20593..20652 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K6162_RS27800 (16253) | 16253..16318 | - | 66 | Protein_22 | helix-turn-helix domain-containing protein | - |
K6162_RS27805 (16371) | 16371..17075 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
K6162_RS27810 (17100) | 17100..17300 | + | 201 | WP_072354025.1 | hypothetical protein | - |
K6162_RS27815 (17320) | 17320..18066 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
K6162_RS27820 (18121) | 18121..18681 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
K6162_RS27825 (18813) | 18813..19013 | + | 201 | WP_015059022.1 | hypothetical protein | - |
K6162_RS27830 (19399) | 19399..19998 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
K6162_RS27835 (20060) | 20060..20392 | + | 333 | WP_152916585.1 | hypothetical protein | - |
- (20593) | 20593..20652 | - | 60 | NuclAT_1 | - | Antitoxin |
- (20593) | 20593..20652 | - | 60 | NuclAT_1 | - | Antitoxin |
- (20593) | 20593..20652 | - | 60 | NuclAT_1 | - | Antitoxin |
- (20593) | 20593..20652 | - | 60 | NuclAT_1 | - | Antitoxin |
K6162_RS27840 (20697) | 20697..20846 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
K6162_RS27845 (21130) | 21130..21378 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
K6162_RS29410 (21493) | 21493..21671 | + | 179 | Protein_32 | protein CopA/IncA | - |
K6162_RS27855 (21690) | 21690..22547 | + | 858 | WP_142295464.1 | incFII family plasmid replication initiator RepA | - |
K6162_RS27860 (23486) | 23486..24139 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
K6162_RS27865 (24232) | 24232..24489 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
K6162_RS27870 (24422) | 24422..24823 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
K6162_RS27875 (25072) | 25072..25487 | + | 416 | Protein_37 | IS1-like element IS1B family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | catA2 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..128480 | 128480 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T213933 WP_001312851.1 NZ_CP082015:20697-20846 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T213933 NZ_CP109921:4073547-4073699 [Escherichia coli O2:K2:H1]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 60 bp
>AT213933 NZ_CP082015:c20652-20593 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|