Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2443914..2444098 | Replicon | chromosome |
Accession | NC_007622 | ||
Organism | Staphylococcus aureus RF122 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | SAB_RS12495 | Protein ID | WP_000482649.1 |
Coordinates | 2443991..2444098 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2443914..2443974 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAB_RS12470 | 2439529..2439696 | - | 168 | WP_001798790.1 | hypothetical protein | - |
SAB_RS12480 | 2439927..2441638 | - | 1712 | Protein_2359 | ABC transporter ATP-binding protein | - |
SAB_RS12485 | 2441663..2443426 | - | 1764 | Protein_2360 | ABC transporter ATP-binding protein | - |
- | 2443914..2443974 | + | 61 | - | - | Antitoxin |
SAB_RS12495 | 2443991..2444098 | - | 108 | WP_000482649.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAB_RS12500 | 2444233..2444619 | - | 387 | WP_000779353.1 | flippase GtxA | - |
SAB_RS12505 | 2444887..2446029 | + | 1143 | WP_001176861.1 | glycerate kinase | - |
SAB_RS12510 | 2446089..2446748 | + | 660 | WP_000831304.1 | hypothetical protein | - |
SAB_RS12515 | 2446931..2448142 | + | 1212 | WP_001191925.1 | multidrug effflux MFS transporter | - |
SAB_RS12520 | 2448265..2448738 | - | 474 | WP_000456485.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3958.73 Da Isoelectric Point: 9.5674
>T21367 WP_000482649.1 NC_007622:c2444098-2443991 [Staphylococcus aureus RF122]
MFNLLINIMTSAISGCLVAFFAHWLRTCNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTCNNKKGDK
Download Length: 108 bp
>T21367 NC_007622:c2444098-2443991 [Staphylococcus aureus RF122]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GTGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GTGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT21367 NC_007622:2443914-2443974 [Staphylococcus aureus RF122]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCGTAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCGTAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|