Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 72272..72526 | Replicon | plasmid unnamed2 |
Accession | NZ_CP081887 | ||
Organism | Escherichia coli strain WW2 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | K5O11_RS24320 | Protein ID | WP_001312851.1 |
Coordinates | 72272..72421 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 72465..72526 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K5O11_RS24290 (67519) | 67519..68430 | - | 912 | WP_000440183.1 | carbamate kinase | - |
K5O11_RS24295 (68441) | 68441..69661 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
K5O11_RS24300 (70368) | 70368..70982 | + | 615 | Protein_81 | VENN motif pre-toxin domain-containing protein | - |
K5O11_RS24305 (70982) | 70982..71428 | - | 447 | Protein_82 | plasmid replication initiator RepA | - |
K5O11_RS24310 (71421) | 71421..71495 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
K5O11_RS24315 (71731) | 71731..71988 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
K5O11_RS24320 (72272) | 72272..72421 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
- (72465) | 72465..72526 | + | 62 | NuclAT_0 | - | Antitoxin |
- (72465) | 72465..72526 | + | 62 | NuclAT_0 | - | Antitoxin |
- (72465) | 72465..72526 | + | 62 | NuclAT_0 | - | Antitoxin |
- (72465) | 72465..72526 | + | 62 | NuclAT_0 | - | Antitoxin |
K5O11_RS24325 (72665) | 72665..72847 | - | 183 | WP_000968309.1 | hypothetical protein | - |
K5O11_RS24330 (72948) | 72948..73564 | + | 617 | Protein_87 | IS1-like element IS1A family transposase | - |
K5O11_RS24335 (73602) | 73602..75173 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
K5O11_RS24340 (75193) | 75193..75540 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
K5O11_RS24345 (75540) | 75540..76217 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
K5O11_RS24350 (76272) | 76272..76361 | + | 90 | Protein_91 | IS1 family transposase | - |
K5O11_RS24355 (76662) | 76662..76874 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) / sitABCD / blaTEM-1B / sul3 / tet(A) / sul2 / floR | iucA / iucB / iucC / iucD / iutA | 1..114381 | 114381 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T213631 WP_001312851.1 NZ_CP081887:c72421-72272 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T213631 NZ_CP109744:c1480437-1480159 [Citrobacter portucalensis]
ATGAATAAACTTACTCACTACGATCCCGCGACTGCGCTGGTTGATGATGAAGAAATTGCCGTGTTTATGGCCGATGCCCT
CGAAACAGGCGATGCAGCATACATTGCAAAAGCACTGGGCGTGGTAGCTCGCGCTAAGGGAATGGCGAACATTGCGGCAG
AAACGGGATTATCCCGCGAGCAGCTTTATCGCTCTTTTAGTGAGAAAGGTAACCCGACGCTGAAAACCACCCTTGCAGTG
ATGAAGGTACTCGGCATTGAATTGACACTTAAAAAATAG
ATGAATAAACTTACTCACTACGATCCCGCGACTGCGCTGGTTGATGATGAAGAAATTGCCGTGTTTATGGCCGATGCCCT
CGAAACAGGCGATGCAGCATACATTGCAAAAGCACTGGGCGTGGTAGCTCGCGCTAAGGGAATGGCGAACATTGCGGCAG
AAACGGGATTATCCCGCGAGCAGCTTTATCGCTCTTTTAGTGAGAAAGGTAACCCGACGCTGAAAACCACCCTTGCAGTG
ATGAAGGTACTCGGCATTGAATTGACACTTAAAAAATAG
Antitoxin
Download Length: 62 bp
>AT213631 NZ_CP081887:72465-72526 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|