Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 152897..153150 | Replicon | plasmid pF726925-1 |
| Accession | NZ_CP081821 | ||
| Organism | Klebsiella pneumoniae strain F726925 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | K5O13_RS27885 | Protein ID | WP_001312851.1 |
| Coordinates | 152897..153046 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 153091..153150 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K5O13_RS27850 (148256) | 148256..148671 | - | 416 | Protein_194 | IS1-like element IS1B family transposase | - |
| K5O13_RS27855 (148920) | 148920..149321 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| K5O13_RS27860 (149254) | 149254..149511 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| K5O13_RS27865 (149604) | 149604..150257 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| K5O13_RS27870 (151196) | 151196..152053 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| K5O13_RS28830 (152072) | 152072..152250 | - | 179 | Protein_199 | protein CopA/IncA | - |
| K5O13_RS27880 (152365) | 152365..152613 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| K5O13_RS27885 (152897) | 152897..153046 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (153091) | 153091..153150 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (153091) | 153091..153150 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (153091) | 153091..153150 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (153091) | 153091..153150 | + | 60 | NuclAT_1 | - | Antitoxin |
| K5O13_RS27890 (153351) | 153351..153683 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| K5O13_RS27895 (153745) | 153745..154344 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| K5O13_RS27900 (154730) | 154730..154930 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| K5O13_RS27905 (155062) | 155062..155622 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| K5O13_RS27910 (155677) | 155677..156423 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| K5O13_RS27915 (156443) | 156443..156643 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| K5O13_RS27920 (156668) | 156668..157372 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| K5O13_RS27925 (157425) | 157425..157490 | + | 66 | Protein_209 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaKPC-2 / rmtB / blaTEM-1B / fosA3 / blaCTX-M-65 / catA2 | - | 1..172862 | 172862 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T213512 WP_001312851.1 NZ_CP081821:c153046-152897 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T213512 NZ_CP109607:1979103-1979205 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 60 bp
>AT213512 NZ_CP081821:153091-153150 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|