Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 152897..153150 Replicon plasmid pF726925-1
Accession NZ_CP081821
Organism Klebsiella pneumoniae strain F726925

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag K5O13_RS27885 Protein ID WP_001312851.1
Coordinates 152897..153046 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 153091..153150 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K5O13_RS27850 (148256) 148256..148671 - 416 Protein_194 IS1-like element IS1B family transposase -
K5O13_RS27855 (148920) 148920..149321 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
K5O13_RS27860 (149254) 149254..149511 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
K5O13_RS27865 (149604) 149604..150257 - 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
K5O13_RS27870 (151196) 151196..152053 - 858 WP_032495102.1 incFII family plasmid replication initiator RepA -
K5O13_RS28830 (152072) 152072..152250 - 179 Protein_199 protein CopA/IncA -
K5O13_RS27880 (152365) 152365..152613 - 249 WP_000083837.1 replication regulatory protein RepA -
K5O13_RS27885 (152897) 152897..153046 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (153091) 153091..153150 + 60 NuclAT_1 - Antitoxin
- (153091) 153091..153150 + 60 NuclAT_1 - Antitoxin
- (153091) 153091..153150 + 60 NuclAT_1 - Antitoxin
- (153091) 153091..153150 + 60 NuclAT_1 - Antitoxin
K5O13_RS27890 (153351) 153351..153683 - 333 WP_152916585.1 hypothetical protein -
K5O13_RS27895 (153745) 153745..154344 - 600 WP_032083981.1 PIN domain-containing protein -
K5O13_RS27900 (154730) 154730..154930 - 201 WP_015059022.1 hypothetical protein -
K5O13_RS27905 (155062) 155062..155622 - 561 WP_000139328.1 fertility inhibition protein FinO -
K5O13_RS27910 (155677) 155677..156423 - 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
K5O13_RS27915 (156443) 156443..156643 - 201 WP_072354025.1 hypothetical protein -
K5O13_RS27920 (156668) 156668..157372 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
K5O13_RS27925 (157425) 157425..157490 + 66 Protein_209 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 / rmtB / blaTEM-1B / fosA3 / blaCTX-M-65 / catA2 - 1..172862 172862


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T213512 WP_001312851.1 NZ_CP081821:c153046-152897 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T213512 NZ_CP109607:1979103-1979205 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT

Antitoxin


Download         Length: 60 bp

>AT213512 NZ_CP081821:153091-153150 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References