Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 15394..15652 | Replicon | chromosome |
Accession | NC_007606 | ||
Organism | Shigella dysenteriae Sd197 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | - |
Locus tag | SDY_RS00075 | Protein ID | WP_038816461.1 |
Coordinates | 15394..15546 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 15595..15652 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SDY_RS00055 | 10635..11348 | - | 714 | WP_001102350.1 | acidic protein MsyB | - |
SDY_RS00060 | 11374..11778 | - | 405 | WP_000843568.1 | DUF2541 family protein | - |
SDY_RS00065 | 12155..14071 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
SDY_RS00070 | 14160..15290 | + | 1131 | WP_001118468.1 | molecular chaperone DnaJ | - |
SDY_RS00075 | 15394..15546 | - | 153 | WP_038816461.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 15595..15652 | + | 58 | - | - | Antitoxin |
SDY_RS00080 | 15865..16558 | - | 694 | Protein_15 | IS1 family transposase | - |
SDY_RS00085 | 16905..18071 | + | 1167 | WP_000681370.1 | Na+/H+ antiporter NhaA | - |
SDY_RS00090 | 18137..19036 | + | 900 | WP_001338226.1 | transcriptional activator NhaR | - |
SDY_RS00095 | 19074..19646 | - | 573 | Protein_18 | fimbrial family protein | - |
SDY_RS00100 | 19712..20406 | + | 695 | WP_087786203.1 | IS1-like element IS1N family transposase | - |
SDY_RS24555 | 20406..20513 | - | 108 | Protein_20 | fimbrial family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 15394..20836 | 5442 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5530.56 Da Isoelectric Point: 7.1312
>T21313 WP_038816461.1 NC_007606:c15546-15394 [Shigella dysenteriae Sd197]
MKQHKAMIVALIVICITAVVAAQVTRKDLCEVHIRTGQTEIAVFTAYESE
MKQHKAMIVALIVICITAVVAAQVTRKDLCEVHIRTGQTEIAVFTAYESE
Download Length: 153 bp
>T21313 NC_007606:c15546-15394 [Shigella dysenteriae Sd197]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCAGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGATTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCAGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGATTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT21313 NC_007606:15595-15652 [Shigella dysenteriae Sd197]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|