Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 186429..186651 | Replicon | chromosome |
Accession | NZ_CP081706 | ||
Organism | Escherichia coli strain AH04 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | J6O21_RS00890 | Protein ID | WP_001295224.1 |
Coordinates | 186544..186651 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 186429..186486 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
J6O21_RS00870 | 182300..183283 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
J6O21_RS00875 | 183280..184284 | + | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
J6O21_RS00880 | 184314..185585 | - | 1272 | WP_001295225.1 | aromatic amino acid transport family protein | - |
J6O21_RS00885 | 186061..186168 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 186429..186486 | - | 58 | - | - | Antitoxin |
J6O21_RS00890 | 186544..186651 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
J6O21_RS00895 | 187027..187134 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
J6O21_RS00900 | 187510..187617 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
J6O21_RS00905 | 187704..189383 | - | 1680 | WP_000191613.1 | cellulose biosynthesis protein BcsG | - |
J6O21_RS00910 | 189380..189571 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
J6O21_RS00915 | 189568..190590 | - | 1023 | Protein_180 | cellulose biosynthesis protein BcsE | - |
J6O21_RS00920 | 190646..191343 | + | 698 | WP_094096600.1 | IS1-like element IS1A family transposase | - |
J6O21_RS00925 | 191360..191482 | + | 123 | Protein_182 | cellulose biosynthesis protein BcsR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T213120 WP_001295224.1 NZ_CP081706:186544-186651 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T213120 NZ_CP107463:4176359-4176577 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA
Antitoxin
Download Length: 58 bp
>AT213120 NZ_CP081706:c186486-186429 [Escherichia coli]
CAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
CAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|