Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 59139..59353 | Replicon | plasmid pE006-TC-121 |
Accession | NZ_CP081506 | ||
Organism | Enterococcus faecalis strain E006xJH2-2-TC1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | K4752_RS14375 | Protein ID | WP_002360667.1 |
Coordinates | 59243..59353 (-) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 59139..59203 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K4752_RS14355 | 54837..55853 | - | 1017 | WP_033593833.1 | replication initiator protein A | - |
K4752_RS14360 | 56516..57367 | + | 852 | WP_002362419.1 | ParA family protein | - |
K4752_RS14365 | 57377..57919 | + | 543 | WP_086321354.1 | hypothetical protein | - |
K4752_RS14370 | 58704..59003 | - | 300 | WP_010817802.1 | hypothetical protein | - |
- | 59139..59203 | + | 65 | - | - | Antitoxin |
K4752_RS14375 | 59243..59353 | - | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
K4752_RS14380 | 59848..60165 | + | 318 | WP_002394802.1 | heavy metal-binding domain-containing protein | - |
K4752_RS14385 | 60201..60869 | + | 669 | WP_002403283.1 | CPBP family intramembrane metalloprotease | - |
K4752_RS14390 | 60986..61240 | + | 255 | WP_002394800.1 | hypothetical protein | - |
K4752_RS14395 | 61400..61633 | - | 234 | WP_002394799.1 | hypothetical protein | - |
K4752_RS14400 | 61635..61919 | - | 285 | WP_002394798.1 | hypothetical protein | - |
K4752_RS14405 | 61936..62556 | - | 621 | WP_162500025.1 | recombinase family protein | - |
K4752_RS14410 | 62760..62990 | + | 231 | WP_002362431.1 | hypothetical protein | - |
K4752_RS14415 | 62990..63331 | + | 342 | WP_002362432.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(B) / ant(6)-Ia / aac(6')-aph(2'') / dfrG / lnu(G) / erm(A) / optrA / poxtA / fexB | prgB/asc10 | 1..121520 | 121520 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T212966 WP_002360667.1 NZ_CP081506:c59353-59243 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T212966 NZ_CP107417:2023365-2023467 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 65 bp
>AT212966 NZ_CP081506:59139-59203 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|