Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4487656..4487876 Replicon chromosome
Accession NZ_CP081489
Organism Escherichia coli BL21(DE3)

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag K5T46_RS21755 Protein ID WP_000170963.1
Coordinates 4487656..4487763 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4487810..4487876 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K5T46_RS21730 4482826..4483914 - 1089 Protein_4271 LacI family DNA-binding transcriptional regulator -
K5T46_RS21735 4483900..4484918 - 1019 Protein_4272 IS3-like element IS150 family transposase -
K5T46_RS21740 4484966..4486000 + 1035 Protein_4273 glutamate decarboxylase -
K5T46_RS21745 4485939..4487030 - 1092 Protein_4274 elongation factor Tu -
K5T46_RS21750 4487121..4487228 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4487276..4487341 + 66 NuclAT_16 - -
- 4487276..4487341 + 66 NuclAT_16 - -
- 4487276..4487341 + 66 NuclAT_16 - -
- 4487276..4487341 + 66 NuclAT_16 - -
- 4487276..4487341 + 66 NuclAT_19 - -
- 4487276..4487341 + 66 NuclAT_19 - -
- 4487276..4487341 + 66 NuclAT_19 - -
- 4487276..4487341 + 66 NuclAT_19 - -
- 4487276..4487341 + 66 NuclAT_22 - -
- 4487276..4487341 + 66 NuclAT_22 - -
- 4487276..4487341 + 66 NuclAT_22 - -
- 4487276..4487341 + 66 NuclAT_22 - -
- 4487276..4487341 + 66 NuclAT_25 - -
- 4487276..4487341 + 66 NuclAT_25 - -
- 4487276..4487341 + 66 NuclAT_25 - -
- 4487276..4487341 + 66 NuclAT_25 - -
- 4487276..4487341 + 66 NuclAT_28 - -
- 4487276..4487341 + 66 NuclAT_28 - -
- 4487276..4487341 + 66 NuclAT_28 - -
- 4487276..4487341 + 66 NuclAT_28 - -
- 4487276..4487341 + 66 NuclAT_31 - -
- 4487276..4487341 + 66 NuclAT_31 - -
- 4487276..4487341 + 66 NuclAT_31 - -
- 4487276..4487341 + 66 NuclAT_31 - -
- 4487276..4487343 + 68 NuclAT_34 - -
- 4487276..4487343 + 68 NuclAT_34 - -
- 4487276..4487343 + 68 NuclAT_34 - -
- 4487276..4487343 + 68 NuclAT_34 - -
- 4487276..4487343 + 68 NuclAT_37 - -
- 4487276..4487343 + 68 NuclAT_37 - -
- 4487276..4487343 + 68 NuclAT_37 - -
- 4487276..4487343 + 68 NuclAT_37 - -
- 4487276..4487343 + 68 NuclAT_40 - -
- 4487276..4487343 + 68 NuclAT_40 - -
- 4487276..4487343 + 68 NuclAT_40 - -
- 4487276..4487343 + 68 NuclAT_40 - -
- 4487276..4487343 + 68 NuclAT_43 - -
- 4487276..4487343 + 68 NuclAT_43 - -
- 4487276..4487343 + 68 NuclAT_43 - -
- 4487276..4487343 + 68 NuclAT_43 - -
- 4487276..4487343 + 68 NuclAT_46 - -
- 4487276..4487343 + 68 NuclAT_46 - -
- 4487276..4487343 + 68 NuclAT_46 - -
- 4487276..4487343 + 68 NuclAT_46 - -
- 4487276..4487343 + 68 NuclAT_49 - -
- 4487276..4487343 + 68 NuclAT_49 - -
- 4487276..4487343 + 68 NuclAT_49 - -
- 4487276..4487343 + 68 NuclAT_49 - -
- 4487277..4487342 + 66 NuclAT_52 - -
- 4487277..4487342 + 66 NuclAT_52 - -
- 4487277..4487342 + 66 NuclAT_52 - -
- 4487277..4487342 + 66 NuclAT_52 - -
- 4487277..4487342 + 66 NuclAT_55 - -
- 4487277..4487342 + 66 NuclAT_55 - -
- 4487277..4487342 + 66 NuclAT_55 - -
- 4487277..4487342 + 66 NuclAT_55 - -
K5T46_RS21755 4487656..4487763 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4487810..4487876 + 67 - - Antitoxin
K5T46_RS21760 4488100..4488207 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
K5T46_RS21765 4488583..4488690 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
K5T46_RS21770 4488947..4489644 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
K5T46_RS21775 4489660..4490307 + 648 Protein_4280 RHS element protein -
K5T46_RS21780 4490299..4490433 + 135 Protein_4281 increased serum survival lipoprotein Iss -
K5T46_RS21785 4490524..4490706 - 183 WP_001228695.1 prophage lysis lipoprotein RzoD -
K5T46_RS21790 4491546..4491665 + 120 Protein_4283 IS3 family transposase -
K5T46_RS21795 4491763..4491915 + 153 WP_000956455.1 type I toxin-antitoxin system toxin HokE -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn aac(3)-Ia tufA 4473030..4489644 16614


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T212924 WP_000170963.1 NZ_CP081489:c4487763-4487656 [Escherichia coli BL21(DE3)]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T212924 NZ_CP107403:3061907-3062275 [Klebsiella pneumoniae]
ATGACGCTGCAGATTATCTCAGCGGAAGAGATAATACAGTTTCACGACAGGCTGCTCCGCGTCACGCCTGGCGTTGCCGG
TATGCCCGATCCAGGGCGTGCCGAAGCGATAATGTATAGGGTGCTAAACAAAATTGAATATGAAGGTGTGACAGACGTGT
GGCGACTCGCTGCGATGCATCTGCTGGCGATTTCTCGCGGTCATATATTTAATGATGGTAATAAGCGTACGGCACTGTTT
ATCACTCTGCTTTTTTTAAAGCGAAATGGAATTATATTGCCGGCGAATCCAGACTTCGTCGGCATGACCGTCGAGGCGGC
AGCAGGGCAACTTACCCTGGAACAGATTGTCGCGCGCTTGCGCGGATGA

Antitoxin


Download         Length: 67 bp

>AT212924 NZ_CP081489:4487810-4487876 [Escherichia coli BL21(DE3)]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References