Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4646276..4646498 Replicon chromosome
Accession NZ_CP081007
Organism Escherichia coli strain XL1-Blue

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag K3826_RS22565 Protein ID WP_000170955.1
Coordinates 4646276..4646383 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4646431..4646498 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K3826_RS22545 (4642252) 4642252..4643058 - 807 Protein_4434 IS30-like element IS30 family transposase -
K3826_RS22915 (4643172) 4643172..4643243 - 72 Protein_4435 hypothetical protein -
K3826_RS22550 (4643238) 4643238..4644332 + 1095 Protein_4436 elongation factor Tu -
K3826_RS22555 (4644269) 4644269..4645258 + 990 Protein_4437 RHS repeat protein -
K3826_RS22920 (4645260) 4645260..4645355 + 96 Protein_4438 DNA-packaging protein -
K3826_RS22560 (4645420) 4645420..4646184 + 765 Protein_4439 phage tail protein -
K3826_RS22565 (4646276) 4646276..4646383 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4646431) 4646431..4646498 + 68 NuclAT_18 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_18 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_18 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_18 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_21 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_21 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_21 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_21 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_24 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_24 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_24 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_24 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_27 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_27 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_27 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_27 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_30 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_30 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_30 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_30 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_33 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_33 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_33 - Antitoxin
- (4646431) 4646431..4646498 + 68 NuclAT_33 - Antitoxin
K3826_RS22570 (4646811) 4646811..4646918 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4646966) 4646966..4647033 + 68 NuclAT_19 - -
- (4646966) 4646966..4647033 + 68 NuclAT_19 - -
- (4646966) 4646966..4647033 + 68 NuclAT_19 - -
- (4646966) 4646966..4647033 + 68 NuclAT_19 - -
- (4646966) 4646966..4647033 + 68 NuclAT_22 - -
- (4646966) 4646966..4647033 + 68 NuclAT_22 - -
- (4646966) 4646966..4647033 + 68 NuclAT_22 - -
- (4646966) 4646966..4647033 + 68 NuclAT_22 - -
- (4646966) 4646966..4647033 + 68 NuclAT_25 - -
- (4646966) 4646966..4647033 + 68 NuclAT_25 - -
- (4646966) 4646966..4647033 + 68 NuclAT_25 - -
- (4646966) 4646966..4647033 + 68 NuclAT_25 - -
- (4646966) 4646966..4647033 + 68 NuclAT_28 - -
- (4646966) 4646966..4647033 + 68 NuclAT_28 - -
- (4646966) 4646966..4647033 + 68 NuclAT_28 - -
- (4646966) 4646966..4647033 + 68 NuclAT_28 - -
- (4646966) 4646966..4647033 + 68 NuclAT_31 - -
- (4646966) 4646966..4647033 + 68 NuclAT_31 - -
- (4646966) 4646966..4647033 + 68 NuclAT_31 - -
- (4646966) 4646966..4647033 + 68 NuclAT_31 - -
- (4646966) 4646966..4647033 + 68 NuclAT_34 - -
- (4646966) 4646966..4647033 + 68 NuclAT_34 - -
- (4646966) 4646966..4647033 + 68 NuclAT_34 - -
- (4646966) 4646966..4647033 + 68 NuclAT_34 - -
K3826_RS22575 (4647073) 4647073..4647770 + 698 WP_223293341.1 IS1-like element IS1B family transposase -
K3826_RS22580 (4647797) 4647797..4648492 - 696 Protein_4443 IS3-like element IS2 family transposase -
K3826_RS22585 (4648493) 4648493..4649146 + 654 Protein_4444 RHS repeat protein -
K3826_RS22590 (4649147) 4649147..4649677 - 531 Protein_4445 DNA-packaging protein -
K3826_RS22605 (4650264) 4650264..4650500 + 237 Protein_4446 ISAs1 family transposase -
K3826_RS22610 (4650678) 4650678..4651145 - 468 WP_141021544.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage formA tufA / rhs/PAAR 4586865..4649677 62812
- inside Prophage - tufA / rhs/PAAR 4596110..4649677 53567
- inside IScluster/Tn - tufA / rhs/PAAR 4618086..4650518 32432


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T212476 WP_000170955.1 NZ_CP081007:c4646383-4646276 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T212476 NZ_CP107043:4780594-4780696 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT

Antitoxin


Download         Length: 68 bp

>AT212476 NZ_CP081007:4646431-4646498 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References