Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3141606..3141828 | Replicon | chromosome |
| Accession | NZ_CP081007 | ||
| Organism | Escherichia coli strain XL1-Blue | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | D3H2K1 |
| Locus tag | K3826_RS14960 | Protein ID | WP_000170955.1 |
| Coordinates | 3141606..3141713 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3141761..3141828 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K3826_RS14935 (3137450) | 3137450..3138532 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| K3826_RS14940 (3138532) | 3138532..3139365 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| K3826_RS14945 (3139362) | 3139362..3139754 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| K3826_RS14950 (3139758) | 3139758..3140567 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| K3826_RS14955 (3140603) | 3140603..3141457 | + | 855 | WP_046613400.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| K3826_RS14960 (3141606) | 3141606..3141713 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_17 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_23 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_26 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_29 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_32 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_32 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_32 | - | Antitoxin |
| - (3141761) | 3141761..3141828 | + | 68 | NuclAT_32 | - | Antitoxin |
| K3826_RS14965 (3142165) | 3142165..3142641 | + | 477 | Protein_2944 | DeoR/GlpR family DNA-binding transcription regulator | - |
| K3826_RS14970 (3142723) | 3142723..3143622 | - | 900 | WP_000807348.1 | lipid kinase YegS | - |
| K3826_RS14975 (3144028) | 3144028..3144345 | + | 318 | WP_001318299.1 | protein YegR | - |
| K3826_RS14980 (3144520) | 3144520..3144732 | + | 213 | Protein_2947 | phage late control D family protein | - |
| K3826_RS14985 (3144814) | 3144814..3145032 | + | 219 | WP_000468310.1 | prophage transcriptional regulator OgrK | - |
| K3826_RS14990 (3145305) | 3145305..3146666 | - | 1362 | WP_000476011.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T212456 WP_000170955.1 NZ_CP081007:c3141713-3141606 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T212456 NZ_CP107039:c507037-506858 [Bacillus subtilis]
ATGTCGACCTATGAATCTCTAATGGTCATGATCGGCTTTGCCAATTTAATAGGCGGGATTATGACATGGGTAATATCTCT
TTTAACATTATTATACATGCTTAGAAAAAAAGACACTCATCCTATTTACATTACTGTAAAGGAAAAGTGTCTACACGAGG
ACCCTCCTATTAAAGGGTAG
ATGTCGACCTATGAATCTCTAATGGTCATGATCGGCTTTGCCAATTTAATAGGCGGGATTATGACATGGGTAATATCTCT
TTTAACATTATTATACATGCTTAGAAAAAAAGACACTCATCCTATTTACATTACTGTAAAGGAAAAGTGTCTACACGAGG
ACCCTCCTATTAAAGGGTAG
Antitoxin
Download Length: 68 bp
>AT212456 NZ_CP081007:3141761-3141828 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
