Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2506921..2507078 | Replicon | chromosome |
Accession | NC_007350 | ||
Organism | Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SSP_RS13055 | Protein ID | WP_002441941.1 |
Coordinates | 2506983..2507078 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2506921..2506954 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SSP_RS12210 | 2502709..2503542 | + | 834 | WP_011304020.1 | aldo/keto reductase | - |
SSP_RS12215 | 2504009..2504308 | - | 300 | WP_011304021.1 | hypothetical protein | - |
SSP_RS12220 | 2504685..2504918 | + | 234 | WP_011304022.1 | ferrous iron transport protein A | - |
SSP_RS13050 | 2504979..2505044 | - | 66 | WP_162009580.1 | type I toxin-antitoxin system Fst family toxin | - |
SSP_RS12225 | 2505232..2506632 | - | 1401 | WP_011304023.1 | RES family NAD+ phosphorylase | - |
- | 2506921..2506954 | + | 34 | - | - | Antitoxin |
SSP_RS13055 | 2506983..2507078 | - | 96 | WP_002441941.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SSP_RS12230 | 2507381..2508139 | - | 759 | WP_011304024.1 | MerR family transcriptional regulator | - |
SSP_RS12235 | 2508249..2508812 | - | 564 | WP_011304025.1 | helix-turn-helix domain-containing protein | - |
SSP_RS12240 | 2509006..2510463 | - | 1458 | WP_011304026.1 | carbon starvation protein A | - |
SSP_RS12245 | 2510671..2511510 | - | 840 | WP_002481957.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3560.34 Da Isoelectric Point: 9.9256
>T21229 WP_002441941.1 NC_007350:c2507078-2506983 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC]
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
Download Length: 96 bp
>T21229 NC_007350:c2507078-2506983 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC]
ATGCTTATGATCTTCGTTCACATCATTGCACCAGTCATTAGTGGCTGTGCAGTTGCGTATTTTACTTATTGGCTTAGTAG
TAAACGCAATAAATAG
ATGCTTATGATCTTCGTTCACATCATTGCACCAGTCATTAGTGGCTGTGCAGTTGCGTATTTTACTTATTGGCTTAGTAG
TAAACGCAATAAATAG
Antitoxin
Download Length: 34 bp
>AT21229 NC_007350:2506921-2506954 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC]
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|