Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1953933..1954113 | Replicon | chromosome |
Accession | NZ_CP080566 | ||
Organism | Staphylococcus aureus strain HL20835 isolate HL20835 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | JMO16_RS09590 | Protein ID | WP_001801861.1 |
Coordinates | 1953933..1954028 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1954056..1954113 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMO16_RS09560 | 1949096..1949746 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
JMO16_RS09565 | 1949827..1950822 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
JMO16_RS09570 | 1950897..1951523 | + | 627 | WP_000669024.1 | hypothetical protein | - |
JMO16_RS09575 | 1951564..1951905 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
JMO16_RS09580 | 1952006..1952578 | + | 573 | WP_000414216.1 | hypothetical protein | - |
JMO16_RS09585 | 1952776..1953788 | - | 1013 | Protein_1903 | IS3 family transposase | - |
JMO16_RS09590 | 1953933..1954028 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1954056..1954113 | - | 58 | - | - | Antitoxin |
JMO16_RS09595 | 1954151..1954252 | + | 102 | WP_001792025.1 | hypothetical protein | - |
JMO16_RS09600 | 1954230..1954391 | - | 162 | Protein_1906 | transposase | - |
JMO16_RS09605 | 1954376..1954786 | - | 411 | WP_001808705.1 | IS21 family transposase | - |
JMO16_RS09610 | 1955328..1956557 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
JMO16_RS09615 | 1956550..1958106 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
JMO16_RS09620 | 1958270..1958404 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1929915..1980945 | 51030 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T212176 WP_001801861.1 NZ_CP080566:1953933-1954028 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T212176 NZ_CP106996:2671044-2671151 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT212176 NZ_CP080566:c1954113-1954056 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|