Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF4/- |
Location | 1987077..1987376 | Replicon | chromosome |
Accession | NZ_CP080564 | ||
Organism | Staphylococcus aureus strain HL16278 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | JMO07_RS09635 | Protein ID | WP_011447039.1 |
Coordinates | 1987200..1987376 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 1987077..1987132 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMO07_RS13620 | 1982643..1982708 | + | 66 | Protein_1865 | hypothetical protein | - |
JMO07_RS09600 | 1982732..1983072 | - | 341 | Protein_1866 | complement inhibitor SCIN-A | - |
JMO07_RS09605 | 1983756..1984205 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
JMO07_RS09610 | 1984300..1984635 | - | 336 | Protein_1868 | SH3 domain-containing protein | - |
JMO07_RS09615 | 1985285..1985776 | - | 492 | WP_000919350.1 | staphylokinase | - |
JMO07_RS09620 | 1985967..1986722 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
JMO07_RS09625 | 1986734..1986988 | - | 255 | WP_000611512.1 | phage holin | - |
JMO07_RS09630 | 1987040..1987147 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1987069..1987208 | + | 140 | NuclAT_0 | - | - |
- | 1987069..1987208 | + | 140 | NuclAT_0 | - | - |
- | 1987069..1987208 | + | 140 | NuclAT_0 | - | - |
- | 1987069..1987208 | + | 140 | NuclAT_0 | - | - |
- | 1987077..1987132 | + | 56 | - | - | Antitoxin |
JMO07_RS09635 | 1987200..1987376 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
JMO07_RS09640 | 1987526..1987822 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
JMO07_RS09645 | 1987880..1988167 | - | 288 | WP_001040261.1 | hypothetical protein | - |
JMO07_RS09650 | 1988214..1988366 | - | 153 | WP_001153681.1 | hypothetical protein | - |
JMO07_RS09655 | 1988356..1992141 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | map / hlb / scn / scn / chp / sak / hlb / groEL | 1977401..2034900 | 57499 | |
- | flank | IS/Tn | - | - | 1981305..1982624 | 1319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T212159 WP_011447039.1 NZ_CP080564:c1987376-1987200 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T212159 NZ_CP106995:c4215162-4214989 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 56 bp
>AT212159 NZ_CP080564:1987077-1987132 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|