Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2630307..2630491 | Replicon | chromosome |
Accession | NZ_CP080562 | ||
Organism | Staphylococcus aureus strain HL21008 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | JMO08_RS13330 | Protein ID | WP_000482652.1 |
Coordinates | 2630384..2630491 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2630307..2630367 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMO08_RS13315 (JMO08_002663) | 2625762..2625893 | - | 132 | WP_223197975.1 | hypothetical protein | - |
JMO08_RS13320 (JMO08_002664) | 2626160..2627893 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein | - |
JMO08_RS13325 (JMO08_002665) | 2627918..2629681 | - | 1764 | WP_220353766.1 | ABC transporter ATP-binding protein | - |
- | 2630307..2630367 | + | 61 | - | - | Antitoxin |
JMO08_RS13330 (JMO08_002666) | 2630384..2630491 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
JMO08_RS13335 (JMO08_002667) | 2630625..2631011 | - | 387 | WP_000779360.1 | flippase GtxA | - |
JMO08_RS13340 (JMO08_002668) | 2631279..2632421 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
JMO08_RS13345 (JMO08_002669) | 2632481..2633140 | + | 660 | WP_000831298.1 | membrane protein | - |
JMO08_RS13350 (JMO08_002670) | 2633322..2634533 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
JMO08_RS13355 (JMO08_002671) | 2634656..2635129 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T212151 WP_000482652.1 NZ_CP080562:c2630491-2630384 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T212151 NZ_CP106995:2670509-2670616 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT212151 NZ_CP080562:2630307-2630367 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|