Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
| Location | 2614148..2614296 | Replicon | chromosome |
| Accession | NC_007168 | ||
| Organism | Staphylococcus haemolyticus JCSC1435 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | SH_RS13630 | Protein ID | WP_011276848.1 |
| Coordinates | 2614148..2614243 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2614261..2614296 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SH_RS12585 | 2609875..2610108 | + | 234 | WP_016931184.1 | hypothetical protein | - |
| SH_RS12590 | 2610216..2610533 | - | 318 | Protein_2472 | IS200/IS605-like element ISSep3 family transposase | - |
| SH_RS13835 | 2611226..2611483 | + | 258 | Protein_2473 | replication initiation protein | - |
| SH_RS12605 | 2612087..2612617 | + | 531 | WP_011276845.1 | N-acetyltransferase | - |
| SH_RS12610 | 2612857..2613240 | + | 384 | WP_011276846.1 | effector binding domain-containing protein | - |
| SH_RS12615 | 2613379..2613683 | + | 305 | Protein_2476 | hypothetical protein | - |
| SH_RS13840 | 2613807..2613953 | + | 147 | WP_000668388.1 | hypothetical protein | - |
| SH_RS13630 | 2614148..2614243 | + | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 2614261..2614296 | + | 36 | - | - | Antitoxin |
| SH_RS12620 | 2614437..2615096 | + | 660 | WP_011276849.1 | nucleotidyltransferase | - |
| SH_RS12625 | 2615342..2615944 | + | 603 | WP_011276850.1 | hypothetical protein | - |
| SH_RS12630 | 2616089..2616904 | - | 816 | WP_000160701.1 | AAA family ATPase | - |
| SH_RS12635 | 2616897..2618339 | - | 1443 | WP_000790709.1 | DDE-type integrase/transposase/recombinase | - |
| SH_RS12640 | 2618311..2618904 | - | 594 | WP_000690636.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2610213..2610533 | 320 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T21208 WP_011276848.1 NC_007168:2614148-2614243 [Staphylococcus haemolyticus JCSC1435]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T21208 NC_007168:2614148-2614243 [Staphylococcus haemolyticus JCSC1435]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 36 bp
>AT21208 NC_007168:2614261-2614296 [Staphylococcus haemolyticus JCSC1435]
TACAACAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAACAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|