Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2200372..2200588 | Replicon | chromosome |
Accession | NZ_CP080551 | ||
Organism | Staphylococcus aureus strain HL18840 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | JMO13_RS10925 | Protein ID | WP_001802298.1 |
Coordinates | 2200484..2200588 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2200372..2200427 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMO13_RS10905 | 2196575..2197240 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
JMO13_RS10910 | 2197392..2197712 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
JMO13_RS10915 | 2197714..2198694 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
JMO13_RS10920 | 2198960..2200051 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
- | 2200372..2200427 | + | 56 | - | - | Antitoxin |
JMO13_RS10925 | 2200484..2200588 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
JMO13_RS10930 | 2201268..2201426 | + | 159 | WP_001792784.1 | hypothetical protein | - |
JMO13_RS10935 | 2202084..2202941 | - | 858 | WP_000370928.1 | HAD family hydrolase | - |
JMO13_RS10940 | 2203009..2203791 | - | 783 | WP_000908189.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T212066 WP_001802298.1 NZ_CP080551:c2200588-2200484 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T212066 NZ_CP106929:c357256-357149 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 56 bp
>AT212066 NZ_CP080551:2200372-2200427 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|