Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF4/- |
Location | 2027443..2027742 | Replicon | chromosome |
Accession | NZ_CP080551 | ||
Organism | Staphylococcus aureus strain HL18840 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | JMO13_RS09955 | Protein ID | WP_011447039.1 |
Coordinates | 2027566..2027742 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2027443..2027498 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMO13_RS09915 | 2022786..2023046 | + | 261 | WP_001791826.1 | hypothetical protein | - |
JMO13_RS09920 | 2023099..2023439 | - | 341 | Protein_1930 | complement inhibitor SCIN-A | - |
JMO13_RS09925 | 2024123..2024571 | + | 449 | Protein_1931 | chemotaxis-inhibiting protein CHIPS | - |
JMO13_RS09930 | 2024666..2025001 | - | 336 | Protein_1932 | SH3 domain-containing protein | - |
JMO13_RS09935 | 2025651..2026142 | - | 492 | WP_000919350.1 | staphylokinase | - |
JMO13_RS09940 | 2026333..2027088 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
JMO13_RS09945 | 2027100..2027354 | - | 255 | WP_000611512.1 | phage holin | - |
JMO13_RS09950 | 2027406..2027513 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2027435..2027574 | + | 140 | NuclAT_0 | - | - |
- | 2027435..2027574 | + | 140 | NuclAT_0 | - | - |
- | 2027435..2027574 | + | 140 | NuclAT_0 | - | - |
- | 2027435..2027574 | + | 140 | NuclAT_0 | - | - |
- | 2027443..2027498 | + | 56 | - | - | Antitoxin |
JMO13_RS09955 | 2027566..2027742 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
JMO13_RS09960 | 2027892..2028188 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
JMO13_RS09965 | 2028246..2028533 | - | 288 | WP_001040261.1 | hypothetical protein | - |
JMO13_RS09970 | 2028580..2028732 | - | 153 | WP_001153681.1 | hypothetical protein | - |
JMO13_RS09975 | 2028722..2032507 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / scn / chp / sak / hlb / groEL | 2023099..2075308 | 52209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T212062 WP_011447039.1 NZ_CP080551:c2027742-2027566 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T212062 NZ_CP106924:c4363138-4362965 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 56 bp
>AT212062 NZ_CP080551:2027443-2027498 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|