Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
| Location | 2331511..2331659 | Replicon | chromosome |
| Accession | NC_007168 | ||
| Organism | Staphylococcus haemolyticus JCSC1435 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | SH_RS13605 | Protein ID | WP_011276560.1 |
| Coordinates | 2331511..2331606 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2331624..2331659 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SH_RS11110 | 2327355..2327771 | - | 417 | WP_011276552.1 | DUF1934 family protein | - |
| SH_RS13595 | 2328060..2328155 | + | 96 | WP_011276553.1 | type I toxin-antitoxin system Fst family toxin | - |
| SH_RS13370 | 2328669..2329175 | + | 507 | Protein_2189 | protein rep | - |
| SH_RS11120 | 2330028..2330246 | + | 219 | WP_011276556.1 | hypothetical protein | - |
| SH_RS13710 | 2330914..2331162 | + | 249 | WP_033080158.1 | hypothetical protein | - |
| SH_RS13605 | 2331511..2331606 | + | 96 | WP_011276560.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 2331624..2331659 | + | 36 | - | - | Antitoxin |
| SH_RS11130 | 2331749..2332519 | - | 771 | WP_011276561.1 | ABC transporter permease | - |
| SH_RS11135 | 2332521..2333216 | - | 696 | WP_011276562.1 | ATP-binding cassette domain-containing protein | - |
| SH_RS11140 | 2333752..2335218 | + | 1467 | WP_000438873.1 | ABC-F type ribosomal protection protein Msr(A) | - |
| SH_RS11145 | 2335317..2336216 | + | 900 | WP_000196697.1 | Mph(C) family macrolide 2'-phosphotransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3670.48 Da Isoelectric Point: 11.0582
>T21205 WP_011276560.1 NC_007168:2331511-2331606 [Staphylococcus haemolyticus JCSC1435]
MLEIFVHITTTVISGCIIALFTHWLRNRKKK
MLEIFVHITTTVISGCIIALFTHWLRNRKKK
Download Length: 96 bp
>T21205 NC_007168:2331511-2331606 [Staphylococcus haemolyticus JCSC1435]
ATGTTGGAAATCTTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAGAAAAAATAG
ATGTTGGAAATCTTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAGAAAAAATAG
Antitoxin
Download Length: 36 bp
>AT21205 NC_007168:2331624-2331659 [Staphylococcus haemolyticus JCSC1435]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|