Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 30205..30474 | Replicon | plasmid pC76-KPC |
Accession | NZ_CP080299 | ||
Organism | Klebsiella pneumoniae strain KP-C76 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | K0E64_RS28290 | Protein ID | WP_001372321.1 |
Coordinates | 30349..30474 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 30205..30270 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K0E64_RS28265 | 25915..26442 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
K0E64_RS28270 | 26500..26733 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
K0E64_RS28275 | 26794..28817 | + | 2024 | Protein_37 | ParB/RepB/Spo0J family partition protein | - |
K0E64_RS28280 | 28886..29320 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
K0E64_RS28285 | 29317..30036 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 30048..30272 | + | 225 | NuclAT_0 | - | - |
- | 30048..30272 | + | 225 | NuclAT_0 | - | - |
- | 30048..30272 | + | 225 | NuclAT_0 | - | - |
- | 30048..30272 | + | 225 | NuclAT_0 | - | - |
- | 30205..30270 | - | 66 | - | - | Antitoxin |
K0E64_RS29715 | 30258..30407 | + | 150 | Protein_40 | plasmid maintenance protein Mok | - |
K0E64_RS28290 | 30349..30474 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
K0E64_RS28295 | 30793..31089 | - | 297 | Protein_42 | hypothetical protein | - |
K0E64_RS28300 | 31389..31685 | + | 297 | WP_001272251.1 | hypothetical protein | - |
K0E64_RS28305 | 31796..32617 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
K0E64_RS28310 | 32914..33561 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
K0E64_RS28315 | 33838..34221 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
K0E64_RS28320 | 34502..35206 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..128928 | 128928 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T211637 WP_001372321.1 NZ_CP080299:30349-30474 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T211637 NZ_CP106660:167205-167504 [Pantoea dispersa]
ATGGGTTCAATCAGGGCGTTTCGTCAGGCCTGGCTGGCACAATTTTATACCCATGGGACACCGCATGCGCAGATTCCGCG
TGCGATTGAATCAGCGCTGGCGCGTAAGCTGGATATCATTCATGCCGCCACTTCGCACCAGGATCTGCGTTCGCCGCCGG
GTAACCGTTTCGAAGCGTTGAAGCCGCCGCTGCTGGGTTACTATTCGATTCGGGTTAACGCGCAGTATCGGCTAATTTTC
CAGTGGGCAAAAGGCGAAGCCTGGGATCTATATCTGGATCCGCACCGCTACAAAAAATAG
ATGGGTTCAATCAGGGCGTTTCGTCAGGCCTGGCTGGCACAATTTTATACCCATGGGACACCGCATGCGCAGATTCCGCG
TGCGATTGAATCAGCGCTGGCGCGTAAGCTGGATATCATTCATGCCGCCACTTCGCACCAGGATCTGCGTTCGCCGCCGG
GTAACCGTTTCGAAGCGTTGAAGCCGCCGCTGCTGGGTTACTATTCGATTCGGGTTAACGCGCAGTATCGGCTAATTTTC
CAGTGGGCAAAAGGCGAAGCCTGGGATCTATATCTGGATCCGCACCGCTACAAAAAATAG
Antitoxin
Download Length: 66 bp
>AT211637 NZ_CP080299:c30270-30205 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|