Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 2551053..2551274 Replicon chromosome
Accession NZ_CP080260
Organism Escherichia coli strain 135

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag KZ312_RS12045 Protein ID WP_000176713.1
Coordinates 2551053..2551160 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 2551208..2551274 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KZ312_RS12020 (2546898) 2546898..2547980 + 1083 WP_000804726.1 peptide chain release factor 1 -
KZ312_RS12025 (2547980) 2547980..2548813 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
KZ312_RS12030 (2548810) 2548810..2549202 + 393 WP_000151883.1 invasion regulator SirB2 -
KZ312_RS12035 (2549206) 2549206..2550015 + 810 WP_001257044.1 invasion regulator SirB1 -
KZ312_RS12040 (2550051) 2550051..2550905 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KZ312_RS12045 (2551053) 2551053..2551160 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2551210) 2551210..2551273 + 64 NuclAT_26 - -
- (2551210) 2551210..2551273 + 64 NuclAT_26 - -
- (2551210) 2551210..2551273 + 64 NuclAT_26 - -
- (2551210) 2551210..2551273 + 64 NuclAT_26 - -
- (2551210) 2551210..2551273 + 64 NuclAT_28 - -
- (2551210) 2551210..2551273 + 64 NuclAT_28 - -
- (2551210) 2551210..2551273 + 64 NuclAT_28 - -
- (2551210) 2551210..2551273 + 64 NuclAT_28 - -
- (2551210) 2551210..2551273 + 64 NuclAT_30 - -
- (2551210) 2551210..2551273 + 64 NuclAT_30 - -
- (2551210) 2551210..2551273 + 64 NuclAT_30 - -
- (2551210) 2551210..2551273 + 64 NuclAT_30 - -
- (2551210) 2551210..2551273 + 64 NuclAT_32 - -
- (2551210) 2551210..2551273 + 64 NuclAT_32 - -
- (2551210) 2551210..2551273 + 64 NuclAT_32 - -
- (2551210) 2551210..2551273 + 64 NuclAT_32 - -
- (2551210) 2551210..2551273 + 64 NuclAT_34 - -
- (2551210) 2551210..2551273 + 64 NuclAT_34 - -
- (2551210) 2551210..2551273 + 64 NuclAT_34 - -
- (2551210) 2551210..2551273 + 64 NuclAT_34 - -
- (2551210) 2551210..2551273 + 64 NuclAT_36 - -
- (2551210) 2551210..2551273 + 64 NuclAT_36 - -
- (2551210) 2551210..2551273 + 64 NuclAT_36 - -
- (2551210) 2551210..2551273 + 64 NuclAT_36 - -
- (2551208) 2551208..2551274 + 67 NuclAT_13 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_13 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_13 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_13 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_15 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_15 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_15 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_15 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_17 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_17 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_17 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_17 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_19 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_19 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_19 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_19 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_21 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_21 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_21 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_21 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_23 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_23 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_23 - Antitoxin
- (2551208) 2551208..2551274 + 67 NuclAT_23 - Antitoxin
- (2551210) 2551210..2551275 + 66 NuclAT_38 - -
- (2551210) 2551210..2551275 + 66 NuclAT_38 - -
- (2551210) 2551210..2551275 + 66 NuclAT_38 - -
- (2551210) 2551210..2551275 + 66 NuclAT_38 - -
- (2551210) 2551210..2551275 + 66 NuclAT_40 - -
- (2551210) 2551210..2551275 + 66 NuclAT_40 - -
- (2551210) 2551210..2551275 + 66 NuclAT_40 - -
- (2551210) 2551210..2551275 + 66 NuclAT_40 - -
KZ312_RS12050 (2551588) 2551588..2551695 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2551748) 2551748..2551809 + 62 NuclAT_25 - -
- (2551748) 2551748..2551809 + 62 NuclAT_25 - -
- (2551748) 2551748..2551809 + 62 NuclAT_25 - -
- (2551748) 2551748..2551809 + 62 NuclAT_25 - -
- (2551748) 2551748..2551809 + 62 NuclAT_27 - -
- (2551748) 2551748..2551809 + 62 NuclAT_27 - -
- (2551748) 2551748..2551809 + 62 NuclAT_27 - -
- (2551748) 2551748..2551809 + 62 NuclAT_27 - -
- (2551748) 2551748..2551809 + 62 NuclAT_29 - -
- (2551748) 2551748..2551809 + 62 NuclAT_29 - -
- (2551748) 2551748..2551809 + 62 NuclAT_29 - -
- (2551748) 2551748..2551809 + 62 NuclAT_29 - -
- (2551748) 2551748..2551809 + 62 NuclAT_31 - -
- (2551748) 2551748..2551809 + 62 NuclAT_31 - -
- (2551748) 2551748..2551809 + 62 NuclAT_31 - -
- (2551748) 2551748..2551809 + 62 NuclAT_31 - -
- (2551748) 2551748..2551809 + 62 NuclAT_33 - -
- (2551748) 2551748..2551809 + 62 NuclAT_33 - -
- (2551748) 2551748..2551809 + 62 NuclAT_33 - -
- (2551748) 2551748..2551809 + 62 NuclAT_33 - -
- (2551748) 2551748..2551809 + 62 NuclAT_35 - -
- (2551748) 2551748..2551809 + 62 NuclAT_35 - -
- (2551748) 2551748..2551809 + 62 NuclAT_35 - -
- (2551748) 2551748..2551809 + 62 NuclAT_35 - -
- (2551748) 2551748..2551810 + 63 NuclAT_14 - -
- (2551748) 2551748..2551810 + 63 NuclAT_14 - -
- (2551748) 2551748..2551810 + 63 NuclAT_14 - -
- (2551748) 2551748..2551810 + 63 NuclAT_14 - -
- (2551748) 2551748..2551810 + 63 NuclAT_16 - -
- (2551748) 2551748..2551810 + 63 NuclAT_16 - -
- (2551748) 2551748..2551810 + 63 NuclAT_16 - -
- (2551748) 2551748..2551810 + 63 NuclAT_16 - -
- (2551748) 2551748..2551810 + 63 NuclAT_18 - -
- (2551748) 2551748..2551810 + 63 NuclAT_18 - -
- (2551748) 2551748..2551810 + 63 NuclAT_18 - -
- (2551748) 2551748..2551810 + 63 NuclAT_18 - -
- (2551748) 2551748..2551810 + 63 NuclAT_20 - -
- (2551748) 2551748..2551810 + 63 NuclAT_20 - -
- (2551748) 2551748..2551810 + 63 NuclAT_20 - -
- (2551748) 2551748..2551810 + 63 NuclAT_20 - -
- (2551748) 2551748..2551810 + 63 NuclAT_22 - -
- (2551748) 2551748..2551810 + 63 NuclAT_22 - -
- (2551748) 2551748..2551810 + 63 NuclAT_22 - -
- (2551748) 2551748..2551810 + 63 NuclAT_22 - -
- (2551748) 2551748..2551810 + 63 NuclAT_24 - -
- (2551748) 2551748..2551810 + 63 NuclAT_24 - -
- (2551748) 2551748..2551810 + 63 NuclAT_24 - -
- (2551748) 2551748..2551810 + 63 NuclAT_24 - -
- (2551748) 2551748..2551811 + 64 NuclAT_37 - -
- (2551748) 2551748..2551811 + 64 NuclAT_37 - -
- (2551748) 2551748..2551811 + 64 NuclAT_37 - -
- (2551748) 2551748..2551811 + 64 NuclAT_37 - -
- (2551748) 2551748..2551811 + 64 NuclAT_39 - -
- (2551748) 2551748..2551811 + 64 NuclAT_39 - -
- (2551748) 2551748..2551811 + 64 NuclAT_39 - -
- (2551748) 2551748..2551811 + 64 NuclAT_39 - -
KZ312_RS12055 (2552101) 2552101..2553201 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
KZ312_RS12060 (2553471) 2553471..2553701 + 231 WP_001146450.1 putative cation transport regulator ChaB -
KZ312_RS12065 (2553859) 2553859..2554554 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
KZ312_RS12070 (2554598) 2554598..2554951 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T211520 WP_000176713.1 NZ_CP080260:c2551160-2551053 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T211520 NZ_CP104913:797251-797598 [Pseudomonas aeruginosa]
ATGTCCCCGGTCGTCATTCGTTTTACTGATACCGCAGAGCAAAGCATCGAAGACCAAGTCCACCACTTGGCTCCATTCCA
AGGTGAACAGGCTGCACTCCAGTCAGTACTGAGCCTTTTGGATGAGATTGAAGAGAAGATTTCACTTGCACCTAAAGGTT
ACCCAGTCAGCCAGCAGGCGAGTCTTCTGGGGGTGCTGAGCTATCGCGAGCTTAATACCGGCCCCTATCGTGTTTTTTAC
GAATTCCACGAAGAGCAAGGCGAGGTGGCAGTGATCTTGGTTTTGCGACAGAAGCAGAGCGTTGAGCAGCAATTGATCCG
CTACTGCTTGGTGGGGCCAATCGAGTGA

Antitoxin


Download         Length: 67 bp

>AT211520 NZ_CP080260:2551208-2551274 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References