Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
Location | 2551053..2551274 | Replicon | chromosome |
Accession | NZ_CP080260 | ||
Organism | Escherichia coli strain 135 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
Locus tag | KZ312_RS12045 | Protein ID | WP_000176713.1 |
Coordinates | 2551053..2551160 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 2551208..2551274 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KZ312_RS12020 (2546898) | 2546898..2547980 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
KZ312_RS12025 (2547980) | 2547980..2548813 | + | 834 | WP_000456458.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
KZ312_RS12030 (2548810) | 2548810..2549202 | + | 393 | WP_000151883.1 | invasion regulator SirB2 | - |
KZ312_RS12035 (2549206) | 2549206..2550015 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
KZ312_RS12040 (2550051) | 2550051..2550905 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
KZ312_RS12045 (2551053) | 2551053..2551160 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_26 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_26 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_26 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_26 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_28 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_28 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_28 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_28 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_30 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_30 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_30 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_30 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_32 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_32 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_32 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_32 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_34 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_34 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_34 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_34 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_36 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_36 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_36 | - | - |
- (2551210) | 2551210..2551273 | + | 64 | NuclAT_36 | - | - |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_13 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_13 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_13 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_13 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_15 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_15 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_15 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_15 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_17 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_17 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_17 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_17 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_19 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_19 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_19 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_19 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_21 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_21 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_21 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_21 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_23 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_23 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_23 | - | Antitoxin |
- (2551208) | 2551208..2551274 | + | 67 | NuclAT_23 | - | Antitoxin |
- (2551210) | 2551210..2551275 | + | 66 | NuclAT_38 | - | - |
- (2551210) | 2551210..2551275 | + | 66 | NuclAT_38 | - | - |
- (2551210) | 2551210..2551275 | + | 66 | NuclAT_38 | - | - |
- (2551210) | 2551210..2551275 | + | 66 | NuclAT_38 | - | - |
- (2551210) | 2551210..2551275 | + | 66 | NuclAT_40 | - | - |
- (2551210) | 2551210..2551275 | + | 66 | NuclAT_40 | - | - |
- (2551210) | 2551210..2551275 | + | 66 | NuclAT_40 | - | - |
- (2551210) | 2551210..2551275 | + | 66 | NuclAT_40 | - | - |
KZ312_RS12050 (2551588) | 2551588..2551695 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_25 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_25 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_25 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_25 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_27 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_27 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_27 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_27 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_29 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_29 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_29 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_29 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_31 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_31 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_31 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_31 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_33 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_33 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_33 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_33 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_35 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_35 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_35 | - | - |
- (2551748) | 2551748..2551809 | + | 62 | NuclAT_35 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_14 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_14 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_14 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_14 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_16 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_16 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_16 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_16 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_18 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_18 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_18 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_18 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_20 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_20 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_20 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_20 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_22 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_22 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_22 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_22 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_24 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_24 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_24 | - | - |
- (2551748) | 2551748..2551810 | + | 63 | NuclAT_24 | - | - |
- (2551748) | 2551748..2551811 | + | 64 | NuclAT_37 | - | - |
- (2551748) | 2551748..2551811 | + | 64 | NuclAT_37 | - | - |
- (2551748) | 2551748..2551811 | + | 64 | NuclAT_37 | - | - |
- (2551748) | 2551748..2551811 | + | 64 | NuclAT_37 | - | - |
- (2551748) | 2551748..2551811 | + | 64 | NuclAT_39 | - | - |
- (2551748) | 2551748..2551811 | + | 64 | NuclAT_39 | - | - |
- (2551748) | 2551748..2551811 | + | 64 | NuclAT_39 | - | - |
- (2551748) | 2551748..2551811 | + | 64 | NuclAT_39 | - | - |
KZ312_RS12055 (2552101) | 2552101..2553201 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
KZ312_RS12060 (2553471) | 2553471..2553701 | + | 231 | WP_001146450.1 | putative cation transport regulator ChaB | - |
KZ312_RS12065 (2553859) | 2553859..2554554 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
KZ312_RS12070 (2554598) | 2554598..2554951 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T211520 WP_000176713.1 NZ_CP080260:c2551160-2551053 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T211520 NZ_CP104913:797251-797598 [Pseudomonas aeruginosa]
ATGTCCCCGGTCGTCATTCGTTTTACTGATACCGCAGAGCAAAGCATCGAAGACCAAGTCCACCACTTGGCTCCATTCCA
AGGTGAACAGGCTGCACTCCAGTCAGTACTGAGCCTTTTGGATGAGATTGAAGAGAAGATTTCACTTGCACCTAAAGGTT
ACCCAGTCAGCCAGCAGGCGAGTCTTCTGGGGGTGCTGAGCTATCGCGAGCTTAATACCGGCCCCTATCGTGTTTTTTAC
GAATTCCACGAAGAGCAAGGCGAGGTGGCAGTGATCTTGGTTTTGCGACAGAAGCAGAGCGTTGAGCAGCAATTGATCCG
CTACTGCTTGGTGGGGCCAATCGAGTGA
ATGTCCCCGGTCGTCATTCGTTTTACTGATACCGCAGAGCAAAGCATCGAAGACCAAGTCCACCACTTGGCTCCATTCCA
AGGTGAACAGGCTGCACTCCAGTCAGTACTGAGCCTTTTGGATGAGATTGAAGAGAAGATTTCACTTGCACCTAAAGGTT
ACCCAGTCAGCCAGCAGGCGAGTCTTCTGGGGGTGCTGAGCTATCGCGAGCTTAATACCGGCCCCTATCGTGTTTTTTAC
GAATTCCACGAAGAGCAAGGCGAGGTGGCAGTGATCTTGGTTTTGCGACAGAAGCAGAGCGTTGAGCAGCAATTGATCCG
CTACTGCTTGGTGGGGCCAATCGAGTGA
Antitoxin
Download Length: 67 bp
>AT211520 NZ_CP080260:2551208-2551274 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|