Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 80153..80407 | Replicon | plasmid pPK8566-169kb |
| Accession | NZ_CP080173 | ||
| Organism | Escherichia coli strain PK8566 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | KZY09_RS23955 | Protein ID | WP_001312851.1 |
| Coordinates | 80153..80302 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 80346..80407 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KZY09_RS23930 (75435) | 75435..78440 | + | 3006 | WP_001143760.1 | Tn3-like element Tn3 family transposase | - |
| KZY09_RS23935 (78373) | 78373..78838 | - | 466 | Protein_74 | plasmid replication initiator RepA | - |
| KZY09_RS23940 (78831) | 78831..79313 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| KZY09_RS26050 (79306) | 79306..79353 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| KZY09_RS26055 (79344) | 79344..79595 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| KZY09_RS23950 (79612) | 79612..79869 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| KZY09_RS23955 (80153) | 80153..80302 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (80346) | 80346..80407 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (80346) | 80346..80407 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (80346) | 80346..80407 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (80346) | 80346..80407 | + | 62 | NuclAT_1 | - | Antitoxin |
| KZY09_RS23960 (80663) | 80663..80737 | - | 75 | Protein_80 | endonuclease | - |
| KZY09_RS23965 (80983) | 80983..81195 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| KZY09_RS23970 (81331) | 81331..81891 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| KZY09_RS23975 (81994) | 81994..82854 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| KZY09_RS23980 (82913) | 82913..83659 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrS1 / tet(A) / sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..169561 | 169561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T211209 WP_001312851.1 NZ_CP080173:c80302-80153 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T211209 NZ_CP104757:c1216762-1216559 [Pectobacterium aroidearum]
ATGAAAAAAATCGACTATTTGATGCGTTTGCGTAAATGCACAACCATTGACACTCTCGAACGCGTTATTGAAAAAAACAA
GTATGAACTCTCTAATGATGAACTGGAGATGTTCTTTTCCGCAGCCGATCATCGTCTGGCAGAACTGACGATGAACAAAC
TTTACGACAAAGTTCCTACCGCAGTATGGCGATACGTCCGTTAA
ATGAAAAAAATCGACTATTTGATGCGTTTGCGTAAATGCACAACCATTGACACTCTCGAACGCGTTATTGAAAAAAACAA
GTATGAACTCTCTAATGATGAACTGGAGATGTTCTTTTCCGCAGCCGATCATCGTCTGGCAGAACTGACGATGAACAAAC
TTTACGACAAAGTTCCTACCGCAGTATGGCGATACGTCCGTTAA
Antitoxin
Download Length: 62 bp
>AT211209 NZ_CP080173:80346-80407 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
