Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1790785..1791005 Replicon chromosome
Accession NZ_CP080172
Organism Escherichia coli strain PK8566

Toxin (Protein)


Gene name ldrD Uniprot ID A0A8S7XT81
Locus tag KZY09_RS08825 Protein ID WP_074147554.1
Coordinates 1790785..1790892 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1790939..1791005 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KZY09_RS08795 1786640..1787473 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
KZY09_RS08800 1787470..1787862 + 393 WP_000200378.1 invasion regulator SirB2 -
KZY09_RS08805 1787866..1788675 + 810 WP_001257044.1 invasion regulator SirB1 -
KZY09_RS08810 1788711..1789565 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KZY09_RS08815 1789714..1789821 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1789869..1789935 + 67 NuclAT_44 - -
- 1789869..1789935 + 67 NuclAT_44 - -
- 1789869..1789935 + 67 NuclAT_44 - -
- 1789869..1789935 + 67 NuclAT_44 - -
- 1789869..1789935 + 67 NuclAT_47 - -
- 1789869..1789935 + 67 NuclAT_47 - -
- 1789869..1789935 + 67 NuclAT_47 - -
- 1789869..1789935 + 67 NuclAT_47 - -
- 1789869..1789935 + 67 NuclAT_50 - -
- 1789869..1789935 + 67 NuclAT_50 - -
- 1789869..1789935 + 67 NuclAT_50 - -
- 1789869..1789935 + 67 NuclAT_50 - -
- 1789871..1789934 + 64 NuclAT_16 - -
- 1789871..1789934 + 64 NuclAT_16 - -
- 1789871..1789934 + 64 NuclAT_16 - -
- 1789871..1789934 + 64 NuclAT_16 - -
- 1789871..1789934 + 64 NuclAT_19 - -
- 1789871..1789934 + 64 NuclAT_19 - -
- 1789871..1789934 + 64 NuclAT_19 - -
- 1789871..1789934 + 64 NuclAT_19 - -
- 1789871..1789934 + 64 NuclAT_22 - -
- 1789871..1789934 + 64 NuclAT_22 - -
- 1789871..1789934 + 64 NuclAT_22 - -
- 1789871..1789934 + 64 NuclAT_22 - -
- 1789871..1789934 + 64 NuclAT_25 - -
- 1789871..1789934 + 64 NuclAT_25 - -
- 1789871..1789934 + 64 NuclAT_25 - -
- 1789871..1789934 + 64 NuclAT_25 - -
- 1789871..1789934 + 64 NuclAT_28 - -
- 1789871..1789934 + 64 NuclAT_28 - -
- 1789871..1789934 + 64 NuclAT_28 - -
- 1789871..1789934 + 64 NuclAT_28 - -
- 1789871..1789934 + 64 NuclAT_31 - -
- 1789871..1789934 + 64 NuclAT_31 - -
- 1789871..1789934 + 64 NuclAT_31 - -
- 1789871..1789934 + 64 NuclAT_31 - -
KZY09_RS08820 1790249..1790356 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1790409..1790470 + 62 NuclAT_15 - -
- 1790409..1790470 + 62 NuclAT_15 - -
- 1790409..1790470 + 62 NuclAT_15 - -
- 1790409..1790470 + 62 NuclAT_15 - -
- 1790409..1790470 + 62 NuclAT_18 - -
- 1790409..1790470 + 62 NuclAT_18 - -
- 1790409..1790470 + 62 NuclAT_18 - -
- 1790409..1790470 + 62 NuclAT_18 - -
- 1790409..1790470 + 62 NuclAT_21 - -
- 1790409..1790470 + 62 NuclAT_21 - -
- 1790409..1790470 + 62 NuclAT_21 - -
- 1790409..1790470 + 62 NuclAT_21 - -
- 1790409..1790470 + 62 NuclAT_24 - -
- 1790409..1790470 + 62 NuclAT_24 - -
- 1790409..1790470 + 62 NuclAT_24 - -
- 1790409..1790470 + 62 NuclAT_24 - -
- 1790409..1790470 + 62 NuclAT_27 - -
- 1790409..1790470 + 62 NuclAT_27 - -
- 1790409..1790470 + 62 NuclAT_27 - -
- 1790409..1790470 + 62 NuclAT_27 - -
- 1790409..1790470 + 62 NuclAT_30 - -
- 1790409..1790470 + 62 NuclAT_30 - -
- 1790409..1790470 + 62 NuclAT_30 - -
- 1790409..1790470 + 62 NuclAT_30 - -
- 1790409..1790471 + 63 NuclAT_45 - -
- 1790409..1790471 + 63 NuclAT_45 - -
- 1790409..1790471 + 63 NuclAT_45 - -
- 1790409..1790471 + 63 NuclAT_45 - -
- 1790409..1790471 + 63 NuclAT_48 - -
- 1790409..1790471 + 63 NuclAT_48 - -
- 1790409..1790471 + 63 NuclAT_48 - -
- 1790409..1790471 + 63 NuclAT_48 - -
- 1790409..1790471 + 63 NuclAT_51 - -
- 1790409..1790471 + 63 NuclAT_51 - -
- 1790409..1790471 + 63 NuclAT_51 - -
- 1790409..1790471 + 63 NuclAT_51 - -
- 1790409..1790472 + 64 NuclAT_33 - -
- 1790409..1790472 + 64 NuclAT_33 - -
- 1790409..1790472 + 64 NuclAT_33 - -
- 1790409..1790472 + 64 NuclAT_33 - -
- 1790409..1790472 + 64 NuclAT_35 - -
- 1790409..1790472 + 64 NuclAT_35 - -
- 1790409..1790472 + 64 NuclAT_35 - -
- 1790409..1790472 + 64 NuclAT_35 - -
- 1790409..1790472 + 64 NuclAT_37 - -
- 1790409..1790472 + 64 NuclAT_37 - -
- 1790409..1790472 + 64 NuclAT_37 - -
- 1790409..1790472 + 64 NuclAT_37 - -
- 1790409..1790472 + 64 NuclAT_39 - -
- 1790409..1790472 + 64 NuclAT_39 - -
- 1790409..1790472 + 64 NuclAT_39 - -
- 1790409..1790472 + 64 NuclAT_39 - -
- 1790409..1790472 + 64 NuclAT_41 - -
- 1790409..1790472 + 64 NuclAT_41 - -
- 1790409..1790472 + 64 NuclAT_41 - -
- 1790409..1790472 + 64 NuclAT_41 - -
- 1790409..1790472 + 64 NuclAT_43 - -
- 1790409..1790472 + 64 NuclAT_43 - -
- 1790409..1790472 + 64 NuclAT_43 - -
- 1790409..1790472 + 64 NuclAT_43 - -
KZY09_RS08825 1790785..1790892 - 108 WP_074147554.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1790939..1791005 + 67 - - Antitoxin
KZY09_RS08830 1791297..1792397 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
KZY09_RS08835 1792667..1792897 + 231 WP_001146442.1 putative cation transport regulator ChaB -
KZY09_RS08840 1793055..1793750 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
KZY09_RS08845 1793794..1794147 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
KZY09_RS08850 1794332..1795726 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T211187 WP_074147554.1 NZ_CP080172:c1790892-1790785 [Escherichia coli]
MTLAQFAMTFWHDLAAPILTGIITAAIVSWWRNRK

Download         Length: 108 bp

>T211187 NZ_CP104745:1570862-1571137 [Erwinia pyrifoliae]
ATGAAAGAACGGGTTTCATTACTACGGAAGAAACAAAAGAGCACGCTTGAACAGATATTTAAATCACCTGTTCAGTCAGG
CATCAGGTGGGCTGATGTGGAGTCGCTGATCAAAGCGCTCGGAGGGGAAGTGAAAGAGGGGCGCGGTTCACGTTGTAAGT
TTCTGCTCAACGGCAGTATCGCCAACTTTCATCGCCCCCACCCTTCACCGGATACGGATAAAGGCGCAGTCGCTAACCTG
CGCGACTGGCTGGAAAGCACGGGAGTGAAACCATGA

Antitoxin


Download         Length: 67 bp

>AT211187 NZ_CP080172:1790939-1791005 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References