Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 1790249..1790470 | Replicon | chromosome |
| Accession | NZ_CP080172 | ||
| Organism | Escherichia coli strain PK8566 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E0IV43 |
| Locus tag | KZY09_RS08820 | Protein ID | WP_000170926.1 |
| Coordinates | 1790249..1790356 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 1790409..1790470 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KZY09_RS08790 (1785558) | 1785558..1786640 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| KZY09_RS08795 (1786640) | 1786640..1787473 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| KZY09_RS08800 (1787470) | 1787470..1787862 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| KZY09_RS08805 (1787866) | 1787866..1788675 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| KZY09_RS08810 (1788711) | 1788711..1789565 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| KZY09_RS08815 (1789714) | 1789714..1789821 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_16 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_16 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_16 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_16 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_19 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_19 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_19 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_19 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_22 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_22 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_22 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_22 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_25 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_25 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_25 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_25 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_28 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_28 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_28 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_28 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_31 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_31 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_31 | - | - |
| - (1789871) | 1789871..1789934 | + | 64 | NuclAT_31 | - | - |
| - (1789869) | 1789869..1789935 | + | 67 | NuclAT_44 | - | - |
| - (1789869) | 1789869..1789935 | + | 67 | NuclAT_44 | - | - |
| - (1789869) | 1789869..1789935 | + | 67 | NuclAT_44 | - | - |
| - (1789869) | 1789869..1789935 | + | 67 | NuclAT_44 | - | - |
| - (1789869) | 1789869..1789935 | + | 67 | NuclAT_47 | - | - |
| - (1789869) | 1789869..1789935 | + | 67 | NuclAT_47 | - | - |
| - (1789869) | 1789869..1789935 | + | 67 | NuclAT_47 | - | - |
| - (1789869) | 1789869..1789935 | + | 67 | NuclAT_47 | - | - |
| - (1789869) | 1789869..1789935 | + | 67 | NuclAT_50 | - | - |
| - (1789869) | 1789869..1789935 | + | 67 | NuclAT_50 | - | - |
| - (1789869) | 1789869..1789935 | + | 67 | NuclAT_50 | - | - |
| - (1789869) | 1789869..1789935 | + | 67 | NuclAT_50 | - | - |
| KZY09_RS08820 (1790249) | 1790249..1790356 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_15 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_15 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_15 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_15 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (1790409) | 1790409..1790470 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (1790409) | 1790409..1790471 | + | 63 | NuclAT_45 | - | - |
| - (1790409) | 1790409..1790471 | + | 63 | NuclAT_45 | - | - |
| - (1790409) | 1790409..1790471 | + | 63 | NuclAT_45 | - | - |
| - (1790409) | 1790409..1790471 | + | 63 | NuclAT_45 | - | - |
| - (1790409) | 1790409..1790471 | + | 63 | NuclAT_48 | - | - |
| - (1790409) | 1790409..1790471 | + | 63 | NuclAT_48 | - | - |
| - (1790409) | 1790409..1790471 | + | 63 | NuclAT_48 | - | - |
| - (1790409) | 1790409..1790471 | + | 63 | NuclAT_48 | - | - |
| - (1790409) | 1790409..1790471 | + | 63 | NuclAT_51 | - | - |
| - (1790409) | 1790409..1790471 | + | 63 | NuclAT_51 | - | - |
| - (1790409) | 1790409..1790471 | + | 63 | NuclAT_51 | - | - |
| - (1790409) | 1790409..1790471 | + | 63 | NuclAT_51 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_33 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_33 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_33 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_33 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_35 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_35 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_35 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_35 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_37 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_37 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_37 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_37 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_39 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_39 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_39 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_39 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_41 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_41 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_41 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_41 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_43 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_43 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_43 | - | - |
| - (1790409) | 1790409..1790472 | + | 64 | NuclAT_43 | - | - |
| KZY09_RS08825 (1790785) | 1790785..1790892 | - | 108 | WP_074147554.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_14 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_14 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_14 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_14 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_17 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_17 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_17 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_17 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_20 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_20 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_20 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_20 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_23 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_23 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_23 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_23 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_26 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_26 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_26 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_26 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_29 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_29 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_29 | - | - |
| - (1790940) | 1790940..1791005 | + | 66 | NuclAT_29 | - | - |
| - (1790941) | 1790941..1791006 | + | 66 | NuclAT_46 | - | - |
| - (1790941) | 1790941..1791006 | + | 66 | NuclAT_46 | - | - |
| - (1790941) | 1790941..1791006 | + | 66 | NuclAT_46 | - | - |
| - (1790941) | 1790941..1791006 | + | 66 | NuclAT_46 | - | - |
| - (1790941) | 1790941..1791006 | + | 66 | NuclAT_49 | - | - |
| - (1790941) | 1790941..1791006 | + | 66 | NuclAT_49 | - | - |
| - (1790941) | 1790941..1791006 | + | 66 | NuclAT_49 | - | - |
| - (1790941) | 1790941..1791006 | + | 66 | NuclAT_49 | - | - |
| - (1790941) | 1790941..1791006 | + | 66 | NuclAT_52 | - | - |
| - (1790941) | 1790941..1791006 | + | 66 | NuclAT_52 | - | - |
| - (1790941) | 1790941..1791006 | + | 66 | NuclAT_52 | - | - |
| - (1790941) | 1790941..1791006 | + | 66 | NuclAT_52 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_32 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_32 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_32 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_32 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_34 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_34 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_34 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_34 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_36 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_36 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_36 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_36 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_38 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_38 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_38 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_38 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_40 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_40 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_40 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_40 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_42 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_42 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_42 | - | - |
| - (1790940) | 1790940..1791007 | + | 68 | NuclAT_42 | - | - |
| KZY09_RS08830 (1791297) | 1791297..1792397 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| KZY09_RS08835 (1792667) | 1792667..1792897 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| KZY09_RS08840 (1793055) | 1793055..1793750 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| KZY09_RS08845 (1793794) | 1793794..1794147 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.84 Da Isoelectric Point: 11.6501
>T211183 WP_000170926.1 NZ_CP080172:c1790356-1790249 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T211183 NZ_CP104745:c522967-522683 [Erwinia pyrifoliae]
ATGAGCTATGAACTGGTCTTCGATCCCAGAGCCTTAAAAGAGTGGAAAAAACTGGGCGCAACGGTTCGGGAGCAGTTCAA
AAAGAAACTGGCGGAAGTGCTGGTAAACCCGAGGGTGGAATCTGCCAGGTTGAGAGAGTACCCGGACTGCTACAAAATAA
AGCTGAAATCATCGGGTTATCGTCTGGTATATCAGGTTCAGGATGAACAGCTGGTTGTCTTCGTTGTGGCGACAGGAAAA
AGAGAAAGGTTACAGGTGTATCGTGACGCAGGAAAGCGCCTGTAA
ATGAGCTATGAACTGGTCTTCGATCCCAGAGCCTTAAAAGAGTGGAAAAAACTGGGCGCAACGGTTCGGGAGCAGTTCAA
AAAGAAACTGGCGGAAGTGCTGGTAAACCCGAGGGTGGAATCTGCCAGGTTGAGAGAGTACCCGGACTGCTACAAAATAA
AGCTGAAATCATCGGGTTATCGTCTGGTATATCAGGTTCAGGATGAACAGCTGGTTGTCTTCGTTGTGGCGACAGGAAAA
AGAGAAAGGTTACAGGTGTATCGTGACGCAGGAAAGCGCCTGTAA
Antitoxin
Download Length: 62 bp
>AT211183 NZ_CP080172:1790409-1790470 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
