Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 132187..132613 | Replicon | plasmid pPK8568-156kb |
Accession | NZ_CP080127 | ||
Organism | Escherichia coli strain PK8568 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | KZY03_RS23280 | Protein ID | WP_001372321.1 |
Coordinates | 132187..132312 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 132389..132613 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KZY03_RS23265 (127689) | 127689..128393 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
KZY03_RS23270 (128458) | 128458..128802 | + | 345 | Protein_132 | recombinase family protein | - |
KZY03_RS23275 (128806) | 128806..131772 | + | 2967 | WP_001138014.1 | Tn3-like element TnAs1 family transposase | - |
KZY03_RS25130 (131749) | 131749..131967 | - | 219 | WP_071780187.1 | hypothetical protein | - |
KZY03_RS23280 (132187) | 132187..132312 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
KZY03_RS25135 (132254) | 132254..132403 | - | 150 | Protein_136 | plasmid maintenance protein Mok | - |
- (132389) | 132389..132613 | - | 225 | NuclAT_0 | - | Antitoxin |
- (132389) | 132389..132613 | - | 225 | NuclAT_0 | - | Antitoxin |
- (132389) | 132389..132613 | - | 225 | NuclAT_0 | - | Antitoxin |
- (132389) | 132389..132613 | - | 225 | NuclAT_0 | - | Antitoxin |
KZY03_RS23285 (132425) | 132425..132613 | + | 189 | WP_001299721.1 | hypothetical protein | - |
KZY03_RS23290 (132582) | 132582..133344 | - | 763 | Protein_138 | plasmid SOS inhibition protein A | - |
KZY03_RS23295 (133341) | 133341..133775 | - | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
KZY03_RS23300 (133830) | 133830..135788 | - | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
KZY03_RS23305 (135847) | 135847..136080 | - | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
KZY03_RS23310 (136136) | 136136..136663 | - | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
KZY03_RS25140 (136982) | 136982..137235 | + | 254 | Protein_143 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | floR / tet(A) / blaTEM-1C / dfrA14 / sitABCD | iroB / iroC / iroD / iroE / iroN | 1..156326 | 156326 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T210980 WP_001372321.1 NZ_CP080127:c132312-132187 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T210980 NZ_CP080127:c132312-132187 [Escherichia coli]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT210980 NZ_CP080127:c132613-132389 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|