Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2508302..2508523 Replicon chromosome
Accession NZ_CP080121
Organism Escherichia coli strain PK8217

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag KZO72_RS12155 Protein ID WP_000170965.1
Coordinates 2508416..2508523 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2508302..2508369 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KZO72_RS12130 2503579..2504973 - 1395 WP_001400233.1 inverse autotransporter invasin YchO -
KZO72_RS12135 2505159..2505512 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
KZO72_RS12140 2505557..2506252 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
KZO72_RS12145 2506410..2506640 - 231 WP_001146444.1 putative cation transport regulator ChaB -
KZO72_RS12150 2506910..2508010 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2508302..2508369 - 68 - - Antitoxin
KZO72_RS12155 2508416..2508523 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2508836..2508903 - 68 NuclAT_44 - -
- 2508836..2508903 - 68 NuclAT_44 - -
- 2508836..2508903 - 68 NuclAT_44 - -
- 2508836..2508903 - 68 NuclAT_44 - -
- 2508837..2508902 - 66 NuclAT_13 - -
- 2508837..2508902 - 66 NuclAT_13 - -
- 2508837..2508902 - 66 NuclAT_13 - -
- 2508837..2508902 - 66 NuclAT_13 - -
- 2508837..2508902 - 66 NuclAT_15 - -
- 2508837..2508902 - 66 NuclAT_15 - -
- 2508837..2508902 - 66 NuclAT_15 - -
- 2508837..2508902 - 66 NuclAT_15 - -
- 2508837..2508902 - 66 NuclAT_17 - -
- 2508837..2508902 - 66 NuclAT_17 - -
- 2508837..2508902 - 66 NuclAT_17 - -
- 2508837..2508902 - 66 NuclAT_17 - -
- 2508837..2508902 - 66 NuclAT_19 - -
- 2508837..2508902 - 66 NuclAT_19 - -
- 2508837..2508902 - 66 NuclAT_19 - -
- 2508837..2508902 - 66 NuclAT_19 - -
- 2508837..2508902 - 66 NuclAT_21 - -
- 2508837..2508902 - 66 NuclAT_21 - -
- 2508837..2508902 - 66 NuclAT_21 - -
- 2508837..2508902 - 66 NuclAT_21 - -
- 2508837..2508902 - 66 NuclAT_23 - -
- 2508837..2508902 - 66 NuclAT_23 - -
- 2508837..2508902 - 66 NuclAT_23 - -
- 2508837..2508902 - 66 NuclAT_23 - -
- 2508838..2508903 - 66 NuclAT_25 - -
- 2508838..2508903 - 66 NuclAT_25 - -
- 2508838..2508903 - 66 NuclAT_25 - -
- 2508838..2508903 - 66 NuclAT_25 - -
- 2508838..2508903 - 66 NuclAT_28 - -
- 2508838..2508903 - 66 NuclAT_28 - -
- 2508838..2508903 - 66 NuclAT_28 - -
- 2508838..2508903 - 66 NuclAT_28 - -
- 2508838..2508903 - 66 NuclAT_31 - -
- 2508838..2508903 - 66 NuclAT_31 - -
- 2508838..2508903 - 66 NuclAT_31 - -
- 2508838..2508903 - 66 NuclAT_31 - -
- 2508838..2508903 - 66 NuclAT_34 - -
- 2508838..2508903 - 66 NuclAT_34 - -
- 2508838..2508903 - 66 NuclAT_34 - -
- 2508838..2508903 - 66 NuclAT_34 - -
- 2508838..2508903 - 66 NuclAT_38 - -
- 2508838..2508903 - 66 NuclAT_38 - -
- 2508838..2508903 - 66 NuclAT_38 - -
- 2508838..2508903 - 66 NuclAT_38 - -
- 2508838..2508903 - 66 NuclAT_41 - -
- 2508838..2508903 - 66 NuclAT_41 - -
- 2508838..2508903 - 66 NuclAT_41 - -
- 2508838..2508903 - 66 NuclAT_41 - -
KZO72_RS12160 2508951..2509058 + 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2509371..2509436 - 66 NuclAT_46 - -
- 2509371..2509436 - 66 NuclAT_46 - -
- 2509371..2509436 - 66 NuclAT_46 - -
- 2509371..2509436 - 66 NuclAT_46 - -
- 2509372..2509438 - 67 NuclAT_12 - -
- 2509372..2509438 - 67 NuclAT_12 - -
- 2509372..2509438 - 67 NuclAT_12 - -
- 2509372..2509438 - 67 NuclAT_12 - -
- 2509372..2509438 - 67 NuclAT_14 - -
- 2509372..2509438 - 67 NuclAT_14 - -
- 2509372..2509438 - 67 NuclAT_14 - -
- 2509372..2509438 - 67 NuclAT_14 - -
- 2509372..2509438 - 67 NuclAT_16 - -
- 2509372..2509438 - 67 NuclAT_16 - -
- 2509372..2509438 - 67 NuclAT_16 - -
- 2509372..2509438 - 67 NuclAT_16 - -
- 2509372..2509438 - 67 NuclAT_18 - -
- 2509372..2509438 - 67 NuclAT_18 - -
- 2509372..2509438 - 67 NuclAT_18 - -
- 2509372..2509438 - 67 NuclAT_18 - -
- 2509372..2509438 - 67 NuclAT_20 - -
- 2509372..2509438 - 67 NuclAT_20 - -
- 2509372..2509438 - 67 NuclAT_20 - -
- 2509372..2509438 - 67 NuclAT_20 - -
- 2509372..2509438 - 67 NuclAT_22 - -
- 2509372..2509438 - 67 NuclAT_22 - -
- 2509372..2509438 - 67 NuclAT_22 - -
- 2509372..2509438 - 67 NuclAT_22 - -
- 2509373..2509436 - 64 NuclAT_27 - -
- 2509373..2509436 - 64 NuclAT_27 - -
- 2509373..2509436 - 64 NuclAT_27 - -
- 2509373..2509436 - 64 NuclAT_27 - -
- 2509373..2509436 - 64 NuclAT_30 - -
- 2509373..2509436 - 64 NuclAT_30 - -
- 2509373..2509436 - 64 NuclAT_30 - -
- 2509373..2509436 - 64 NuclAT_30 - -
- 2509373..2509436 - 64 NuclAT_33 - -
- 2509373..2509436 - 64 NuclAT_33 - -
- 2509373..2509436 - 64 NuclAT_33 - -
- 2509373..2509436 - 64 NuclAT_33 - -
- 2509373..2509436 - 64 NuclAT_36 - -
- 2509373..2509436 - 64 NuclAT_36 - -
- 2509373..2509436 - 64 NuclAT_36 - -
- 2509373..2509436 - 64 NuclAT_36 - -
- 2509373..2509436 - 64 NuclAT_40 - -
- 2509373..2509436 - 64 NuclAT_40 - -
- 2509373..2509436 - 64 NuclAT_40 - -
- 2509373..2509436 - 64 NuclAT_40 - -
- 2509373..2509436 - 64 NuclAT_43 - -
- 2509373..2509436 - 64 NuclAT_43 - -
- 2509373..2509436 - 64 NuclAT_43 - -
- 2509373..2509436 - 64 NuclAT_43 - -
KZO72_RS12165 2509486..2509593 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
KZO72_RS12170 2509740..2510594 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KZO72_RS12175 2510630..2511439 - 810 WP_001257044.1 invasion regulator SirB1 -
KZO72_RS12180 2511443..2511835 - 393 WP_001409175.1 invasion regulator SirB2 -
KZO72_RS12185 2511832..2512665 - 834 WP_032177158.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T210944 WP_000170965.1 NZ_CP080121:2508416-2508523 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T210944 NZ_CP104647:c1839702-1839427 [Escherichia coli]
ATGAGAACCAAGGTACAGGCTTTACGGAAGAAACAAAAAAATACATTGGATCAAATATTTAAAACTCCTGTTCCTCAAGG
GATCAAGTGGTCTGATATAGAGTCACTGGTTAAAGCATTAGGCGGAGAAATTAAGGAAGGAAGAGGTTCGCGTTGTAAGT
TCATACTAAATATGAGCGTTGCGTGTTTCCATCGGCCTCATCCGTCGCCAGATACCGATAAAGGCGCTGTAGAAAGCGTG
CGTGACTGGTTACTAAGTATAGGGGTAAAACCATGA

Antitoxin


Download         Length: 68 bp

>AT210944 NZ_CP080121:c2508369-2508302 [Escherichia coli]
TGTCTGGTTTCAAGATTAGGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References