210887

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3674875..3675096 Replicon chromosome
Accession NZ_CP080119
Organism Escherichia coli strain M45

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag KZX76_RS17915 Protein ID WP_001531632.1
Coordinates 3674875..3674982 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3675030..3675096 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KZX76_RS17890 (3670719) 3670719..3671801 + 1083 WP_000804726.1 peptide chain release factor 1 -
KZX76_RS17895 (3671801) 3671801..3672634 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
KZX76_RS17900 (3672631) 3672631..3673023 + 393 WP_000200375.1 invasion regulator SirB2 -
KZX76_RS17905 (3673027) 3673027..3673836 + 810 WP_001257044.1 invasion regulator SirB1 -
KZX76_RS17910 (3673872) 3673872..3674726 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KZX76_RS17915 (3674875) 3674875..3674982 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (3675032) 3675032..3675095 + 64 NuclAT_12 - -
- (3675032) 3675032..3675095 + 64 NuclAT_12 - -
- (3675032) 3675032..3675095 + 64 NuclAT_12 - -
- (3675032) 3675032..3675095 + 64 NuclAT_12 - -
- (3675032) 3675032..3675095 + 64 NuclAT_13 - -
- (3675032) 3675032..3675095 + 64 NuclAT_13 - -
- (3675032) 3675032..3675095 + 64 NuclAT_13 - -
- (3675032) 3675032..3675095 + 64 NuclAT_13 - -
- (3675032) 3675032..3675095 + 64 NuclAT_14 - -
- (3675032) 3675032..3675095 + 64 NuclAT_14 - -
- (3675032) 3675032..3675095 + 64 NuclAT_14 - -
- (3675032) 3675032..3675095 + 64 NuclAT_14 - -
- (3675032) 3675032..3675095 + 64 NuclAT_15 - -
- (3675032) 3675032..3675095 + 64 NuclAT_15 - -
- (3675032) 3675032..3675095 + 64 NuclAT_15 - -
- (3675032) 3675032..3675095 + 64 NuclAT_15 - -
- (3675032) 3675032..3675095 + 64 NuclAT_16 - -
- (3675032) 3675032..3675095 + 64 NuclAT_16 - -
- (3675032) 3675032..3675095 + 64 NuclAT_16 - -
- (3675032) 3675032..3675095 + 64 NuclAT_16 - -
- (3675032) 3675032..3675095 + 64 NuclAT_17 - -
- (3675032) 3675032..3675095 + 64 NuclAT_17 - -
- (3675032) 3675032..3675095 + 64 NuclAT_17 - -
- (3675032) 3675032..3675095 + 64 NuclAT_17 - -
- (3675030) 3675030..3675096 + 67 NuclAT_10 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_10 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_10 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_10 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_5 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_5 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_5 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_5 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_6 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_6 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_6 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_6 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_7 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_7 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_7 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_7 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_8 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_8 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_8 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_8 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_9 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_9 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_9 - Antitoxin
- (3675030) 3675030..3675096 + 67 NuclAT_9 - Antitoxin
- (3675032) 3675032..3675097 + 66 NuclAT_18 - -
- (3675032) 3675032..3675097 + 66 NuclAT_18 - -
- (3675032) 3675032..3675097 + 66 NuclAT_18 - -
- (3675032) 3675032..3675097 + 66 NuclAT_18 - -
- (3675032) 3675032..3675097 + 66 NuclAT_19 - -
- (3675032) 3675032..3675097 + 66 NuclAT_19 - -
- (3675032) 3675032..3675097 + 66 NuclAT_19 - -
- (3675032) 3675032..3675097 + 66 NuclAT_19 - -
- (3675032) 3675032..3675097 + 66 NuclAT_20 - -
- (3675032) 3675032..3675097 + 66 NuclAT_20 - -
- (3675032) 3675032..3675097 + 66 NuclAT_20 - -
- (3675032) 3675032..3675097 + 66 NuclAT_20 - -
- (3675032) 3675032..3675097 + 66 NuclAT_21 - -
- (3675032) 3675032..3675097 + 66 NuclAT_21 - -
- (3675032) 3675032..3675097 + 66 NuclAT_21 - -
- (3675032) 3675032..3675097 + 66 NuclAT_21 - -
- (3675032) 3675032..3675097 + 66 NuclAT_22 - -
- (3675032) 3675032..3675097 + 66 NuclAT_22 - -
- (3675032) 3675032..3675097 + 66 NuclAT_22 - -
- (3675032) 3675032..3675097 + 66 NuclAT_22 - -
- (3675032) 3675032..3675097 + 66 NuclAT_23 - -
- (3675032) 3675032..3675097 + 66 NuclAT_23 - -
- (3675032) 3675032..3675097 + 66 NuclAT_23 - -
- (3675032) 3675032..3675097 + 66 NuclAT_23 - -
KZX76_RS17920 (3675387) 3675387..3676487 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
KZX76_RS17925 (3676757) 3676757..3676996 + 240 WP_000120702.1 putative cation transport regulator ChaB -
KZX76_RS17930 (3677145) 3677145..3677840 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
KZX76_RS17935 (3677884) 3677884..3678237 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
KZX76_RS17940 (3678422) 3678422..3679816 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T210887 WP_001531632.1 NZ_CP080119:c3674982-3674875 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T210887 NZ_CP104641:3635579-3635836 [Salmonella enterica]
ATGAATGCCTCCGGCGTCAGCGTCCGCCACATCAACAGCAAAACCCACATGACCACCTATTACTCACAAATCCCCAGCCT
GCATCTTAAGGGCGACTGGCTGGAAGAAGCGGGATTTAAGACCGGGCGCGGCGTCACCGTGAAGATTTCACAGGGGTGTA
TTGTGCTGATGGCGGACAGTAACGAGGAGCAGAAGCTGCGCGAGCAGCTTTATCAGGCTAAACAGGTGGTTAAGGGAATT
AAGGACGTGCTGGTTTAG

Antitoxin


Download         Length: 67 bp

>AT210887 NZ_CP080119:3675030-3675096 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References