Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokC/Ldr(toxin)
Location 2881056..2881275 Replicon chromosome
Accession NZ_CP079891
Organism Escherichia fergusonii strain 5zf15-2-1

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag KYD87_RS14365 Protein ID WP_000170738.1
Coordinates 2881056..2881163 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokC
Locus tag -
Coordinates 2881212..2881275 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KYD87_RS14340 (2876590) 2876590..2876778 - 189 WP_001063310.1 cellulose biosynthesis protein BcsR -
KYD87_RS14345 (2877065) 2877065..2878624 + 1560 WP_223665908.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
KYD87_RS14350 (2878621) 2878621..2878812 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
KYD87_RS14355 (2878809) 2878809..2880488 + 1680 WP_182211153.1 cellulose biosynthesis protein BcsG -
KYD87_RS14360 (2880574) 2880574..2880681 - 108 WP_002431793.1 type I toxin-antitoxin system toxin Ldr family protein -
KYD87_RS14365 (2881056) 2881056..2881163 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2881212) 2881212..2881275 + 64 NuclAT_15 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_15 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_15 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_15 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_17 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_17 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_17 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_17 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_19 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_19 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_19 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_19 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_21 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_21 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_21 - Antitoxin
- (2881212) 2881212..2881275 + 64 NuclAT_21 - Antitoxin
- (2881212) 2881212..2881277 + 66 NuclAT_10 - -
- (2881212) 2881212..2881277 + 66 NuclAT_10 - -
- (2881212) 2881212..2881277 + 66 NuclAT_10 - -
- (2881212) 2881212..2881277 + 66 NuclAT_10 - -
- (2881212) 2881212..2881277 + 66 NuclAT_12 - -
- (2881212) 2881212..2881277 + 66 NuclAT_12 - -
- (2881212) 2881212..2881277 + 66 NuclAT_12 - -
- (2881212) 2881212..2881277 + 66 NuclAT_12 - -
KYD87_RS14370 (2881539) 2881539..2881646 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2881695) 2881695..2881758 + 64 NuclAT_14 - -
- (2881695) 2881695..2881758 + 64 NuclAT_14 - -
- (2881695) 2881695..2881758 + 64 NuclAT_14 - -
- (2881695) 2881695..2881758 + 64 NuclAT_14 - -
- (2881695) 2881695..2881758 + 64 NuclAT_16 - -
- (2881695) 2881695..2881758 + 64 NuclAT_16 - -
- (2881695) 2881695..2881758 + 64 NuclAT_16 - -
- (2881695) 2881695..2881758 + 64 NuclAT_16 - -
- (2881695) 2881695..2881758 + 64 NuclAT_18 - -
- (2881695) 2881695..2881758 + 64 NuclAT_18 - -
- (2881695) 2881695..2881758 + 64 NuclAT_18 - -
- (2881695) 2881695..2881758 + 64 NuclAT_18 - -
- (2881695) 2881695..2881758 + 64 NuclAT_20 - -
- (2881695) 2881695..2881758 + 64 NuclAT_20 - -
- (2881695) 2881695..2881758 + 64 NuclAT_20 - -
- (2881695) 2881695..2881758 + 64 NuclAT_20 - -
- (2881695) 2881695..2881760 + 66 NuclAT_11 - -
- (2881695) 2881695..2881760 + 66 NuclAT_11 - -
- (2881695) 2881695..2881760 + 66 NuclAT_11 - -
- (2881695) 2881695..2881760 + 66 NuclAT_11 - -
- (2881695) 2881695..2881760 + 66 NuclAT_9 - -
- (2881695) 2881695..2881760 + 66 NuclAT_9 - -
- (2881695) 2881695..2881760 + 66 NuclAT_9 - -
- (2881695) 2881695..2881760 + 66 NuclAT_9 - -
KYD87_RS14375 (2882083) 2882083..2883279 + 1197 WP_223665909.1 methionine gamma-lyase -
KYD87_RS14380 (2883529) 2883529..2884827 + 1299 WP_105283531.1 amino acid permease -
KYD87_RS14385 (2884843) 2884843..2886054 - 1212 WP_105283532.1 sigma 54-interacting transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T210335 WP_000170738.1 NZ_CP079891:c2881163-2881056 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp

>T210335 NZ_CP104500:c4430434-4430099 [Escherichia coli]
ATGAAAATTATTCCTGCAACGACGCTGCGGGCGACGACGTCATATCTGTCGCCTGTCGTGGTCTGGCAAACATTACTGGC
CCGCCTGCTGGAGCAGCACTACGGGCTGAATCTTAATGACACACCATTCAACAATGAAAAGGTGATTCAGGAACACATAG
ACGCCGGGATCACTCTGGTCGATGCCGTCAATTTTCTGGTGGAGAAGTACGAGTTGATCCGTATCGACAGGAAAGGATTT
AGCTGGCAGGAACAGACGCCTTATCTTCGTGCGGTCGATATTTTACGGGCGCGGCAGGCTACAGGTCTGCTGCGCCGCTG
CCATAACACGCCATAA

Antitoxin


Download         Length: 64 bp

>AT210335 NZ_CP079891:2881212-2881275 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829L523

Antitoxin

Download structure file

References