Detailed information of TA system TA210326

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 1224058..1224283
• Replicon: chromosome
• Accession: NZ_CP079891
• Organism: Escherichia fergusonii strain 5zf15-2-1

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: -
• Locus tag: KYD87_RS06345
• Protein ID: WP_000813255.1
• Coordinates: 1224058..1224213 (-)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	1224225..1224283 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
KYD87_RS06285	1219160..1219693	-	534	WP_000992100.1	lysozyme	-
KYD87_RS06290	1219757..1220107	-	351	WP_000193280.1	YdfR family protein	-
KYD87_RS06295	1220112..1220327	-	216	WP_000839572.1	class II holin family protein	-
KYD87_RS06320	1221123..1221812	-	690	WP_001064894.1	bacteriophage antitermination protein Q	-
KYD87_RS06325	1221809..1222174	-	366	WP_000140004.1	RusA family crossover junction endodeoxyribonuclease	-
KYD87_RS06330	1222175..1223230	-	1056	WP_223666277.1	DUF968 domain-containing protein	-
KYD87_RS06335	1223232..1223510	-	279	WP_078207408.1	hypothetical protein	-
KYD87_RS06340	1223577..1223837	-	261	WP_000687435.1	hypothetical protein	-
KYD87_RS06345	1224058..1224213	-	156	WP_000813255.1	type I toxin-antitoxin system toxin HokD	Toxin
-	1224225..1224283	+	59	-	-	Antitoxin
KYD87_RS06350	1224456..1224632	-	177	WP_194285216.1	hypothetical protein	-
KYD87_RS06355	1224625..1224807	-	183	WP_001224672.1	hypothetical protein	-
KYD87_RS06360	1224901..1225257	-	357	WP_039022684.1	hypothetical protein	-
KYD87_RS06365	1225315..1225737	-	423	WP_078207410.1	DUF977 family protein	-
KYD87_RS06370	1225753..1226523	-	771	WP_039022663.1	DUF1627 domain-containing protein	-
KYD87_RS06375	1226556..1227017	-	462	WP_239637900.1	replication protein P	-
KYD87_RS06380	1227010..1228050	-	1041	WP_039022662.1	DnaT-like ssDNA-binding domain-containing protein	-
KYD87_RS06385	1228022..1228573	-	552	WP_000705377.1	toxin YdaT family protein	-
KYD87_RS06390	1228557..1228784	-	228	WP_000476986.1	Cro/CI family transcriptional regulator	-
KYD87_RS06395	1228862..1229269	+	408	WP_001003379.1	helix-turn-helix domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	1180941..1239376	58435

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5726.85 Da
• Isoelectric Point: 6.1531

>T210326 WP_000813255.1 NZ_CP079891:c1224213-1224058 [Escherichia fergusonii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYESEE

Nucleotide

• Length: 156 bp

>T210326 NZ_CP104500:c2084292-2084185 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 59 bp

>AT210326 NZ_CP079891:1224225-1224283 [Escherichia fergusonii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATATGCCGTTCATAGATTGAGCCTCA

Structures

Antitoxin