Detailed information of TA system TA210307

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokA/Ldr(toxin)
• Location: 4451446..4451667
• Replicon: chromosome
• Accession: NZ_CP079884
• Organism: Escherichia fergusonii strain 6S41-1

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: S1NWX0
• Locus tag: KYC43_RS21755
• Protein ID: WP_001295224.1
• Coordinates: 4451446..4451553 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokA
Locus tag	-
Coordinates	4451601..4451667 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
KYC43_RS21725	4446488..4448047	+	1560	WP_223665908.1	cellulose biosynthesis c-di-GMP-binding protein BcsE	-
KYC43_RS21730	4448044..4448235	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
KYC43_RS21735	4448232..4449911	+	1680	WP_182211153.1	cellulose biosynthesis protein BcsG	-
KYC43_RS21740	4449998..4450105	-	108	WP_000170746.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4450163..4450217	+	55	NuclAT_18	-	-
-	4450163..4450217	+	55	NuclAT_18	-	-
-	4450163..4450217	+	55	NuclAT_18	-	-
-	4450163..4450217	+	55	NuclAT_18	-	-
-	4450163..4450217	+	55	NuclAT_21	-	-
-	4450163..4450217	+	55	NuclAT_21	-	-
-	4450163..4450217	+	55	NuclAT_21	-	-
-	4450163..4450217	+	55	NuclAT_21	-	-
-	4450163..4450217	+	55	NuclAT_24	-	-
-	4450163..4450217	+	55	NuclAT_24	-	-
-	4450163..4450217	+	55	NuclAT_24	-	-
-	4450163..4450217	+	55	NuclAT_24	-	-
-	4450163..4450217	+	55	NuclAT_27	-	-
-	4450163..4450217	+	55	NuclAT_27	-	-
-	4450163..4450217	+	55	NuclAT_27	-	-
-	4450163..4450217	+	55	NuclAT_27	-	-
-	4450163..4450219	+	57	NuclAT_11	-	-
-	4450163..4450219	+	57	NuclAT_11	-	-
-	4450163..4450219	+	57	NuclAT_11	-	-
-	4450163..4450219	+	57	NuclAT_11	-	-
-	4450163..4450219	+	57	NuclAT_14	-	-
-	4450163..4450219	+	57	NuclAT_14	-	-
-	4450163..4450219	+	57	NuclAT_14	-	-
-	4450163..4450219	+	57	NuclAT_14	-	-
KYC43_RS21745	4450481..4450588	-	108	WP_002431793.1	type I toxin-antitoxin system toxin Ldr family protein	-
KYC43_RS21750	4450963..4451070	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4451119..4451182	+	64	NuclAT_17	-	-
-	4451119..4451182	+	64	NuclAT_17	-	-
-	4451119..4451182	+	64	NuclAT_17	-	-
-	4451119..4451182	+	64	NuclAT_17	-	-
-	4451119..4451182	+	64	NuclAT_20	-	-
-	4451119..4451182	+	64	NuclAT_20	-	-
-	4451119..4451182	+	64	NuclAT_20	-	-
-	4451119..4451182	+	64	NuclAT_20	-	-
-	4451119..4451182	+	64	NuclAT_23	-	-
-	4451119..4451182	+	64	NuclAT_23	-	-
-	4451119..4451182	+	64	NuclAT_23	-	-
-	4451119..4451182	+	64	NuclAT_23	-	-
-	4451119..4451182	+	64	NuclAT_26	-	-
-	4451119..4451182	+	64	NuclAT_26	-	-
-	4451119..4451182	+	64	NuclAT_26	-	-
-	4451119..4451182	+	64	NuclAT_26	-	-
-	4451119..4451184	+	66	NuclAT_10	-	-
-	4451119..4451184	+	66	NuclAT_10	-	-
-	4451119..4451184	+	66	NuclAT_10	-	-
-	4451119..4451184	+	66	NuclAT_10	-	-
-	4451119..4451184	+	66	NuclAT_13	-	-
-	4451119..4451184	+	66	NuclAT_13	-	-
-	4451119..4451184	+	66	NuclAT_13	-	-
-	4451119..4451184	+	66	NuclAT_13	-	-
KYC43_RS21755	4451446..4451553	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4451601..4451667	+	67	-	-	Antitoxin
KYC43_RS21760	4451990..4453186	+	1197	WP_223671879.1	methionine gamma-lyase	-
KYC43_RS21765	4453436..4454734	+	1299	WP_105283531.1	amino acid permease	-
KYC43_RS21770	4454750..4455961	-	1212	WP_105283532.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3882.70 Da
• Isoelectric Point: 9.0157

>T210307 WP_001295224.1 NZ_CP079884:c4451553-4451446 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Nucleotide

• Length: 108 bp

>T210307 NZ_CP104491:c4229054-4228770 [Salmonella enterica]
ATGACTTATGAACTGGAATTCGACCCGAGGGCCTTAAAAGAGTGGCATAAGCTGGGCGATACGGTGAAGGCTCAGCTTAA
GAAAAAGTTGGCTGATGTGCTATTGAACCCCAGAATCGACTCTGTCCGTTTAAACGATCTTCCTGACTGCTATAAAATTA
AGCTTAAATCGTCCGGTTATCGTCTGGTGTACCAGGTTCGGGATGAAGTTGTGATTGTGTTTGTTGTTGCGGTCGGCAAG
CGAGAACATTCAGCCGTCTATCACGATGCAAACAAACGGCTTTAG

Antitoxin

Nucleotide

• Length: 67 bp

>AT210307 NZ_CP079884:4451601-4451667 [Escherichia fergusonii]
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A4P7TSJ7

Antitoxin