Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokA/Ldr(toxin)
Location 4449998..4450217 Replicon chromosome
Accession NZ_CP079884
Organism Escherichia fergusonii strain 6S41-1

Toxin (Protein)


Gene name ldrD Uniprot ID A0A826RQE3
Locus tag KYC43_RS21740 Protein ID WP_000170746.1
Coordinates 4449998..4450105 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 4450163..4450217 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KYC43_RS21715 (4445234) 4445234..4446001 - 768 WP_182211159.1 cellulose biosynthesis protein BcsQ -
KYC43_RS21720 (4446013) 4446013..4446201 - 189 WP_001063310.1 cellulose biosynthesis protein BcsR -
KYC43_RS21725 (4446488) 4446488..4448047 + 1560 WP_223665908.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
KYC43_RS21730 (4448044) 4448044..4448235 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
KYC43_RS21735 (4448232) 4448232..4449911 + 1680 WP_182211153.1 cellulose biosynthesis protein BcsG -
KYC43_RS21740 (4449998) 4449998..4450105 - 108 WP_000170746.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4450163) 4450163..4450217 + 55 NuclAT_18 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_18 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_18 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_18 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_21 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_21 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_21 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_21 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_24 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_24 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_24 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_24 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_27 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_27 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_27 - Antitoxin
- (4450163) 4450163..4450217 + 55 NuclAT_27 - Antitoxin
- (4450163) 4450163..4450219 + 57 NuclAT_11 - -
- (4450163) 4450163..4450219 + 57 NuclAT_11 - -
- (4450163) 4450163..4450219 + 57 NuclAT_11 - -
- (4450163) 4450163..4450219 + 57 NuclAT_11 - -
- (4450163) 4450163..4450219 + 57 NuclAT_14 - -
- (4450163) 4450163..4450219 + 57 NuclAT_14 - -
- (4450163) 4450163..4450219 + 57 NuclAT_14 - -
- (4450163) 4450163..4450219 + 57 NuclAT_14 - -
KYC43_RS21745 (4450481) 4450481..4450588 - 108 WP_002431793.1 type I toxin-antitoxin system toxin Ldr family protein -
KYC43_RS21750 (4450963) 4450963..4451070 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4451119) 4451119..4451182 + 64 NuclAT_17 - -
- (4451119) 4451119..4451182 + 64 NuclAT_17 - -
- (4451119) 4451119..4451182 + 64 NuclAT_17 - -
- (4451119) 4451119..4451182 + 64 NuclAT_17 - -
- (4451119) 4451119..4451182 + 64 NuclAT_20 - -
- (4451119) 4451119..4451182 + 64 NuclAT_20 - -
- (4451119) 4451119..4451182 + 64 NuclAT_20 - -
- (4451119) 4451119..4451182 + 64 NuclAT_20 - -
- (4451119) 4451119..4451182 + 64 NuclAT_23 - -
- (4451119) 4451119..4451182 + 64 NuclAT_23 - -
- (4451119) 4451119..4451182 + 64 NuclAT_23 - -
- (4451119) 4451119..4451182 + 64 NuclAT_23 - -
- (4451119) 4451119..4451182 + 64 NuclAT_26 - -
- (4451119) 4451119..4451182 + 64 NuclAT_26 - -
- (4451119) 4451119..4451182 + 64 NuclAT_26 - -
- (4451119) 4451119..4451182 + 64 NuclAT_26 - -
- (4451119) 4451119..4451184 + 66 NuclAT_10 - -
- (4451119) 4451119..4451184 + 66 NuclAT_10 - -
- (4451119) 4451119..4451184 + 66 NuclAT_10 - -
- (4451119) 4451119..4451184 + 66 NuclAT_10 - -
- (4451119) 4451119..4451184 + 66 NuclAT_13 - -
- (4451119) 4451119..4451184 + 66 NuclAT_13 - -
- (4451119) 4451119..4451184 + 66 NuclAT_13 - -
- (4451119) 4451119..4451184 + 66 NuclAT_13 - -
KYC43_RS21755 (4451446) 4451446..4451553 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4451602) 4451602..4451665 + 64 NuclAT_16 - -
- (4451602) 4451602..4451665 + 64 NuclAT_16 - -
- (4451602) 4451602..4451665 + 64 NuclAT_16 - -
- (4451602) 4451602..4451665 + 64 NuclAT_16 - -
- (4451602) 4451602..4451665 + 64 NuclAT_19 - -
- (4451602) 4451602..4451665 + 64 NuclAT_19 - -
- (4451602) 4451602..4451665 + 64 NuclAT_19 - -
- (4451602) 4451602..4451665 + 64 NuclAT_19 - -
- (4451602) 4451602..4451665 + 64 NuclAT_22 - -
- (4451602) 4451602..4451665 + 64 NuclAT_22 - -
- (4451602) 4451602..4451665 + 64 NuclAT_22 - -
- (4451602) 4451602..4451665 + 64 NuclAT_22 - -
- (4451602) 4451602..4451665 + 64 NuclAT_25 - -
- (4451602) 4451602..4451665 + 64 NuclAT_25 - -
- (4451602) 4451602..4451665 + 64 NuclAT_25 - -
- (4451602) 4451602..4451665 + 64 NuclAT_25 - -
- (4451602) 4451602..4451667 + 66 NuclAT_12 - -
- (4451602) 4451602..4451667 + 66 NuclAT_12 - -
- (4451602) 4451602..4451667 + 66 NuclAT_12 - -
- (4451602) 4451602..4451667 + 66 NuclAT_12 - -
- (4451602) 4451602..4451667 + 66 NuclAT_9 - -
- (4451602) 4451602..4451667 + 66 NuclAT_9 - -
- (4451602) 4451602..4451667 + 66 NuclAT_9 - -
- (4451602) 4451602..4451667 + 66 NuclAT_9 - -
KYC43_RS21760 (4451990) 4451990..4453186 + 1197 WP_223671879.1 methionine gamma-lyase -
KYC43_RS21765 (4453436) 4453436..4454734 + 1299 WP_105283531.1 amino acid permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3912.73 Da        Isoelectric Point: 9.0157

>T210300 WP_000170746.1 NZ_CP079884:c4450105-4449998 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVITGILASMIVNWLNKRK

Download         Length: 108 bp

>T210300 NZ_CP104491:c1001207-1000680 [Salmonella enterica]
ATGATGTTTACAGACTGGCATGAGGCCGCGATAGGGAAAACCCACAATCGAATGAATTTTGATTGTGGGGATGCCGATCT
GAACCAATTCCTGCAACGCCATGCACGACAAAATCATGAGAAAGGGACAACGAAAACCTATGTTGCGCTTGATAATTCGG
ATGTTACACGTATCCACGGCTTTTACTCAGTCAGTCCTGCATCACTGATATATGCACAGGTTCCCGGCGCAATCAGCAAA
GGATTAGGGAGATACGATGTGCCAGTGTTTCGTCTGGGTCGTTTAGCCGTAGACAAATCTATGCAGGGGCAAGGGCTGGG
AGCACAACTTTTGTTATCTGCCGGAAAGCGTTGCATACAGGCGGCTTTGCAGGTCGGTGGCGTAGCCCTACTTATTGATG
CCAAAAATAAACAGGTCTGCGACTGGTACAAAGGATTTGGCGCAGTACCATTAAACGATCAACCCCTTTCCTTGTTGCTG
TCGTTTAAAACGCTTTATGCTGCTTTATCTGCATCTGGTAGGTTATGA

Antitoxin


Download         Length: 55 bp

>AT210300 NZ_CP079884:4450163-4450217 [Escherichia fergusonii]
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A826RQE3

Antitoxin

Download structure file

References