Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2039294..2039519 | Replicon | chromosome |
| Accession | NC_004741 | ||
| Organism | Shigella flexneri 2a str. 2457T | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | S_RS11340 | Protein ID | WP_000813254.1 |
| Coordinates | 2039294..2039449 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2039461..2039519 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| S_RS11285 | 2034606..2034956 | - | 351 | WP_005048975.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| S_RS11290 | 2034953..2035627 | - | 675 | WP_004967157.1 | IS66 family insertion sequence hypothetical protein | - |
| S_RS11295 | 2035726..2035941 | - | 216 | WP_000839572.1 | class II holin family protein | - |
| S_RS11320 | 2036742..2037425 | - | 684 | WP_005049343.1 | antiterminator | - |
| S_RS11325 | 2037422..2037787 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
| S_RS11330 | 2037788..2038846 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| S_RS26080 | 2038848..2039126 | - | 279 | WP_011069426.1 | hypothetical protein | - |
| S_RS11340 | 2039294..2039449 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2039461..2039519 | + | 59 | - | - | Antitoxin |
| S_RS11350 | 2040101..2040517 | - | 417 | WP_005069274.1 | hypothetical protein | - |
| S_RS11355 | 2040544..2040684 | + | 141 | Protein_2057 | DUF4224 domain-containing protein | - |
| S_RS11360 | 2040684..2041709 | + | 1026 | WP_000533619.1 | tyrosine-type recombinase/integrase | - |
| S_RS11370 | 2041945..2042742 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
| S_RS11380 | 2043080..2044342 | + | 1263 | Protein_2060 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 2021895..2073955 | 52060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T20946 WP_000813254.1 NC_004741:c2039449-2039294 [Shigella flexneri 2a str. 2457T]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T20946 NC_004741:c2039449-2039294 [Shigella flexneri 2a str. 2457T]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT20946 NC_004741:2039461-2039519 [Shigella flexneri 2a str. 2457T]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|