Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 312154..312349 | Replicon | chromosome |
Accession | NZ_CP078162 | ||
Organism | Enterococcus faecalis strain NS2 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | KVY10_RS01570 | Protein ID | WP_122975133.1 |
Coordinates | 312254..312349 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 312154..312219 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KVY10_RS01555 | 307781..309529 | + | 1749 | WP_218391392.1 | PTS transporter subunit EIIC | - |
KVY10_RS01560 | 309520..311553 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
KVY10_RS01565 | 311564..311998 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 312154..312219 | + | 66 | - | - | Antitoxin |
KVY10_RS01570 | 312254..312349 | - | 96 | WP_122975133.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
KVY10_RS01575 | 312595..314367 | + | 1773 | WP_002405272.1 | PTS mannitol-specific transporter subunit IIBC | - |
KVY10_RS01580 | 314382..314819 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
KVY10_RS01585 | 314834..315988 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
KVY10_RS01590 | 316055..317170 | - | 1116 | WP_174083960.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.5869
>T209151 WP_122975133.1 NZ_CP078162:c312349-312254 [Enterococcus faecalis]
MYDIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYDIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T209151 NZ_CP103864:c1754659-1754552 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT209151 NZ_CP078162:312154-312219 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|