Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 304666..304861 | Replicon | chromosome |
Accession | NZ_CP078015 | ||
Organism | Enterococcus faecalis strain SY-1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | KUO14_RS01530 | Protein ID | WP_015543884.1 |
Coordinates | 304766..304861 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 304666..304731 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KUO14_RS01515 | 300297..302039 | + | 1743 | WP_002401739.1 | PTS transporter subunit EIIC | - |
KUO14_RS01520 | 302030..304063 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
KUO14_RS01525 | 304074..304508 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 304666..304731 | + | 66 | - | - | Antitoxin |
KUO14_RS01530 | 304766..304861 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
KUO14_RS01535 | 305107..306879 | + | 1773 | WP_002391520.1 | PTS mannitol-specific transporter subunit IIBC | - |
KUO14_RS01540 | 306894..307331 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
KUO14_RS01545 | 307346..308500 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
KUO14_RS01550 | 308569..309684 | - | 1116 | WP_002377910.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T208884 WP_015543884.1 NZ_CP078015:c304861-304766 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T208884 NZ_CP103751:c2937575-2937472 [Enterobacter asburiae]
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 66 bp
>AT208884 NZ_CP078015:304666-304731 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|