Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-symR/Ldr(toxin) |
Location | 1139760..1139982 | Replicon | chromosome |
Accession | NZ_CP077969 | ||
Organism | Escherichia coli strain JM83 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | D3H2K1 |
Locus tag | KTJ86_RS05505 | Protein ID | WP_000170955.1 |
Coordinates | 1139760..1139867 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 1139915..1139982 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KTJ86_RS05475 (1135616) | 1135616..1136449 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
KTJ86_RS05480 (1136446) | 1136446..1136838 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
KTJ86_RS05485 (1136842) | 1136842..1137651 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
KTJ86_RS05490 (1137687) | 1137687..1138541 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
KTJ86_RS05495 (1138690) | 1138690..1138797 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_33 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_33 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_33 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_33 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_35 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_35 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_35 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_35 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_37 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_37 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_37 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_37 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_39 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_39 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_39 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_39 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_41 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_41 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_41 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_41 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_43 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_43 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_43 | - | - |
- (1138845) | 1138845..1138911 | + | 67 | NuclAT_43 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_17 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_17 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_17 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_17 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_20 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_20 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_20 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_20 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_23 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_23 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_23 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_23 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_26 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_26 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_26 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_26 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_29 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_29 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_29 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_29 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_32 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_32 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_32 | - | - |
- (1138847) | 1138847..1138912 | + | 66 | NuclAT_32 | - | - |
KTJ86_RS05500 (1139225) | 1139225..1139332 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_34 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_34 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_34 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_34 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_36 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_36 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_36 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_36 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_38 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_38 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_38 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_38 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_40 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_40 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_40 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_40 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_42 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_42 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_42 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_42 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_44 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_44 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_44 | - | - |
- (1139381) | 1139381..1139446 | + | 66 | NuclAT_44 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_16 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_16 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_16 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_16 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_19 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_19 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_19 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_19 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_22 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_22 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_22 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_22 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_25 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_25 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_25 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_25 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_28 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_28 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_28 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_28 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_31 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_31 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_31 | - | - |
- (1139380) | 1139380..1139447 | + | 68 | NuclAT_31 | - | - |
KTJ86_RS05505 (1139760) | 1139760..1139867 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_15 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_15 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_15 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_15 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_18 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_18 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_18 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_18 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_21 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_21 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_21 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_21 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_24 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_24 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_24 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_24 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_27 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_27 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_27 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_27 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_30 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_30 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_30 | - | Antitoxin |
- (1139915) | 1139915..1139982 | + | 68 | NuclAT_30 | - | Antitoxin |
KTJ86_RS05510 (1140271) | 1140271..1141371 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
KTJ86_RS05515 (1141641) | 1141641..1141871 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
KTJ86_RS05520 (1142029) | 1142029..1142724 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
KTJ86_RS05525 (1142768) | 1142768..1143121 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
KTJ86_RS05530 (1143306) | 1143306..1144700 | + | 1395 | WP_000086217.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T208748 WP_000170955.1 NZ_CP077969:c1139867-1139760 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T208748 NZ_CP103718:c4471827-4471477 [Escherichia coli]
ATGGTAAAGAAAAGTGAATTTGAACGGGGAGACATTGTGCTGGTTGGCTTTGATCCAGCAAGCGGCCATGAACAGCAAGG
TGCTGGTCGACCTGCGCTTGTGCTCTCCGTTCAAGCCTTTAATCAACTGGGAATGACGCTGGTGGCCCCCATTACGCAGG
GCGGAAATTTTGCCCGTTATGCCGGATTTAGCGTTCCTTTACATTGCGAAGAAGGCGATGTGCACGGCGTGGTGCTGGTG
AATCAGGTGCGGATGATGGATCTACGCGCCCGGCTGGCAAAGCGTATTGGTCTGGCTGCGGGTGAGGTGGTGGAAGAGGC
GTTATTACGTTTGCAGGCGGTGGTGGAATAA
ATGGTAAAGAAAAGTGAATTTGAACGGGGAGACATTGTGCTGGTTGGCTTTGATCCAGCAAGCGGCCATGAACAGCAAGG
TGCTGGTCGACCTGCGCTTGTGCTCTCCGTTCAAGCCTTTAATCAACTGGGAATGACGCTGGTGGCCCCCATTACGCAGG
GCGGAAATTTTGCCCGTTATGCCGGATTTAGCGTTCCTTTACATTGCGAAGAAGGCGATGTGCACGGCGTGGTGCTGGTG
AATCAGGTGCGGATGATGGATCTACGCGCCCGGCTGGCAAAGCGTATTGGTCTGGCTGCGGGTGAGGTGGTGGAAGAGGC
GTTATTACGTTTGCAGGCGGTGGTGGAATAA
Antitoxin
Download Length: 68 bp
>AT208748 NZ_CP077969:1139915-1139982 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|