Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1139225..1139447 Replicon chromosome
Accession NZ_CP077969
Organism Escherichia coli strain JM83

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag KTJ86_RS05500 Protein ID WP_000170963.1
Coordinates 1139225..1139332 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1139380..1139447 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KTJ86_RS05470 (1134534) 1134534..1135616 + 1083 WP_000804726.1 peptide chain release factor 1 -
KTJ86_RS05475 (1135616) 1135616..1136449 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
KTJ86_RS05480 (1136446) 1136446..1136838 + 393 WP_000200374.1 invasion regulator SirB2 -
KTJ86_RS05485 (1136842) 1136842..1137651 + 810 WP_001257044.1 invasion regulator SirB1 -
KTJ86_RS05490 (1137687) 1137687..1138541 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KTJ86_RS05495 (1138690) 1138690..1138797 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1138845) 1138845..1138911 + 67 NuclAT_33 - -
- (1138845) 1138845..1138911 + 67 NuclAT_33 - -
- (1138845) 1138845..1138911 + 67 NuclAT_33 - -
- (1138845) 1138845..1138911 + 67 NuclAT_33 - -
- (1138845) 1138845..1138911 + 67 NuclAT_35 - -
- (1138845) 1138845..1138911 + 67 NuclAT_35 - -
- (1138845) 1138845..1138911 + 67 NuclAT_35 - -
- (1138845) 1138845..1138911 + 67 NuclAT_35 - -
- (1138845) 1138845..1138911 + 67 NuclAT_37 - -
- (1138845) 1138845..1138911 + 67 NuclAT_37 - -
- (1138845) 1138845..1138911 + 67 NuclAT_37 - -
- (1138845) 1138845..1138911 + 67 NuclAT_37 - -
- (1138845) 1138845..1138911 + 67 NuclAT_39 - -
- (1138845) 1138845..1138911 + 67 NuclAT_39 - -
- (1138845) 1138845..1138911 + 67 NuclAT_39 - -
- (1138845) 1138845..1138911 + 67 NuclAT_39 - -
- (1138845) 1138845..1138911 + 67 NuclAT_41 - -
- (1138845) 1138845..1138911 + 67 NuclAT_41 - -
- (1138845) 1138845..1138911 + 67 NuclAT_41 - -
- (1138845) 1138845..1138911 + 67 NuclAT_41 - -
- (1138845) 1138845..1138911 + 67 NuclAT_43 - -
- (1138845) 1138845..1138911 + 67 NuclAT_43 - -
- (1138845) 1138845..1138911 + 67 NuclAT_43 - -
- (1138845) 1138845..1138911 + 67 NuclAT_43 - -
- (1138847) 1138847..1138912 + 66 NuclAT_17 - -
- (1138847) 1138847..1138912 + 66 NuclAT_17 - -
- (1138847) 1138847..1138912 + 66 NuclAT_17 - -
- (1138847) 1138847..1138912 + 66 NuclAT_17 - -
- (1138847) 1138847..1138912 + 66 NuclAT_20 - -
- (1138847) 1138847..1138912 + 66 NuclAT_20 - -
- (1138847) 1138847..1138912 + 66 NuclAT_20 - -
- (1138847) 1138847..1138912 + 66 NuclAT_20 - -
- (1138847) 1138847..1138912 + 66 NuclAT_23 - -
- (1138847) 1138847..1138912 + 66 NuclAT_23 - -
- (1138847) 1138847..1138912 + 66 NuclAT_23 - -
- (1138847) 1138847..1138912 + 66 NuclAT_23 - -
- (1138847) 1138847..1138912 + 66 NuclAT_26 - -
- (1138847) 1138847..1138912 + 66 NuclAT_26 - -
- (1138847) 1138847..1138912 + 66 NuclAT_26 - -
- (1138847) 1138847..1138912 + 66 NuclAT_26 - -
- (1138847) 1138847..1138912 + 66 NuclAT_29 - -
- (1138847) 1138847..1138912 + 66 NuclAT_29 - -
- (1138847) 1138847..1138912 + 66 NuclAT_29 - -
- (1138847) 1138847..1138912 + 66 NuclAT_29 - -
- (1138847) 1138847..1138912 + 66 NuclAT_32 - -
- (1138847) 1138847..1138912 + 66 NuclAT_32 - -
- (1138847) 1138847..1138912 + 66 NuclAT_32 - -
- (1138847) 1138847..1138912 + 66 NuclAT_32 - -
KTJ86_RS05500 (1139225) 1139225..1139332 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1139381) 1139381..1139446 + 66 NuclAT_34 - -
- (1139381) 1139381..1139446 + 66 NuclAT_34 - -
- (1139381) 1139381..1139446 + 66 NuclAT_34 - -
- (1139381) 1139381..1139446 + 66 NuclAT_34 - -
- (1139381) 1139381..1139446 + 66 NuclAT_36 - -
- (1139381) 1139381..1139446 + 66 NuclAT_36 - -
- (1139381) 1139381..1139446 + 66 NuclAT_36 - -
- (1139381) 1139381..1139446 + 66 NuclAT_36 - -
- (1139381) 1139381..1139446 + 66 NuclAT_38 - -
- (1139381) 1139381..1139446 + 66 NuclAT_38 - -
- (1139381) 1139381..1139446 + 66 NuclAT_38 - -
- (1139381) 1139381..1139446 + 66 NuclAT_38 - -
- (1139381) 1139381..1139446 + 66 NuclAT_40 - -
- (1139381) 1139381..1139446 + 66 NuclAT_40 - -
- (1139381) 1139381..1139446 + 66 NuclAT_40 - -
- (1139381) 1139381..1139446 + 66 NuclAT_40 - -
- (1139381) 1139381..1139446 + 66 NuclAT_42 - -
- (1139381) 1139381..1139446 + 66 NuclAT_42 - -
- (1139381) 1139381..1139446 + 66 NuclAT_42 - -
- (1139381) 1139381..1139446 + 66 NuclAT_42 - -
- (1139381) 1139381..1139446 + 66 NuclAT_44 - -
- (1139381) 1139381..1139446 + 66 NuclAT_44 - -
- (1139381) 1139381..1139446 + 66 NuclAT_44 - -
- (1139381) 1139381..1139446 + 66 NuclAT_44 - -
- (1139380) 1139380..1139447 + 68 NuclAT_16 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_16 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_16 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_16 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_19 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_19 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_19 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_19 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_22 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_22 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_22 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_22 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_25 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_25 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_25 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_25 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_28 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_28 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_28 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_28 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_31 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_31 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_31 - Antitoxin
- (1139380) 1139380..1139447 + 68 NuclAT_31 - Antitoxin
KTJ86_RS05505 (1139760) 1139760..1139867 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1139915) 1139915..1139982 + 68 NuclAT_15 - -
- (1139915) 1139915..1139982 + 68 NuclAT_15 - -
- (1139915) 1139915..1139982 + 68 NuclAT_15 - -
- (1139915) 1139915..1139982 + 68 NuclAT_15 - -
- (1139915) 1139915..1139982 + 68 NuclAT_18 - -
- (1139915) 1139915..1139982 + 68 NuclAT_18 - -
- (1139915) 1139915..1139982 + 68 NuclAT_18 - -
- (1139915) 1139915..1139982 + 68 NuclAT_18 - -
- (1139915) 1139915..1139982 + 68 NuclAT_21 - -
- (1139915) 1139915..1139982 + 68 NuclAT_21 - -
- (1139915) 1139915..1139982 + 68 NuclAT_21 - -
- (1139915) 1139915..1139982 + 68 NuclAT_21 - -
- (1139915) 1139915..1139982 + 68 NuclAT_24 - -
- (1139915) 1139915..1139982 + 68 NuclAT_24 - -
- (1139915) 1139915..1139982 + 68 NuclAT_24 - -
- (1139915) 1139915..1139982 + 68 NuclAT_24 - -
- (1139915) 1139915..1139982 + 68 NuclAT_27 - -
- (1139915) 1139915..1139982 + 68 NuclAT_27 - -
- (1139915) 1139915..1139982 + 68 NuclAT_27 - -
- (1139915) 1139915..1139982 + 68 NuclAT_27 - -
- (1139915) 1139915..1139982 + 68 NuclAT_30 - -
- (1139915) 1139915..1139982 + 68 NuclAT_30 - -
- (1139915) 1139915..1139982 + 68 NuclAT_30 - -
- (1139915) 1139915..1139982 + 68 NuclAT_30 - -
KTJ86_RS05510 (1140271) 1140271..1141371 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
KTJ86_RS05515 (1141641) 1141641..1141871 + 231 WP_001146444.1 putative cation transport regulator ChaB -
KTJ86_RS05520 (1142029) 1142029..1142724 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
KTJ86_RS05525 (1142768) 1142768..1143121 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T208745 WP_000170963.1 NZ_CP077969:c1139332-1139225 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T208745 NZ_CP103718:c3965518-3965120 [Escherichia coli]
ATGCGGGTATTCAAAACAAAACTTATTCGCCTGCAACTTACAGCAGAGGAACTTGATGCGTTAACGGCGGATTTTATTTC
CTATAAGCGTGACGGTATTTTGCCAGATATATTTGGTCGCGATGCACTCTACGACGACTCGTTTACCTGGCCATTAATCA
AATTTGAGCGAGTTGCTCATATTCATCTGGCAAATGTGAATAATCCATTTCCGCCACAGTTGCGCCAATTCAGCAGAACG
AATGACGAAGCGCATTTGGTATATTGTCAGGGGGCGTTTGATGAGCAAGCATGGTTGCTCATTGCCATTCTGAAGCCTGA
ACCTCATAAACTGGCTCGAGATAACAACCAAATGCATAAAATTGGAAAAATGGCAGAAGCGTTTCGCATGCGTTTTTGA

Antitoxin


Download         Length: 68 bp

>AT208745 NZ_CP077969:1139380-1139447 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References