Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1565049..1565231 | Replicon | chromosome |
Accession | NZ_CP077933 | ||
Organism | Staphylococcus aureus strain 359 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | KU512_RS07840 | Protein ID | WP_001801861.1 |
Coordinates | 1565049..1565144 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1565172..1565231 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU512_RS07800 | 1560708..1561334 | + | 627 | WP_000669046.1 | hypothetical protein | - |
KU512_RS07805 | 1561375..1561719 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
KU512_RS07810 | 1561817..1562368 | + | 552 | WP_000414205.1 | hypothetical protein | - |
KU512_RS07815 | 1562586..1563227 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
KU512_RS07820 | 1563342..1563527 | - | 186 | WP_000809857.1 | hypothetical protein | - |
KU512_RS07825 | 1563529..1563705 | - | 177 | WP_000375476.1 | hypothetical protein | - |
KU512_RS07830 | 1563716..1564099 | - | 384 | WP_000070812.1 | hypothetical protein | - |
KU512_RS07835 | 1564703..1564846 | - | 144 | WP_001549059.1 | transposase | - |
KU512_RS07840 | 1565049..1565144 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1565172..1565231 | - | 60 | - | - | Antitoxin |
KU512_RS07845 | 1565267..1565368 | + | 102 | WP_001791893.1 | hypothetical protein | - |
KU512_RS07850 | 1565346..1565522 | - | 177 | Protein_1544 | transposase | - |
KU512_RS07855 | 1565716..1566093 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T208696 WP_001801861.1 NZ_CP077933:1565049-1565144 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T208696 NZ_CP103710:2074889-2074991 [Escherichia coli O25b:H4-ST131]
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 60 bp
>AT208696 NZ_CP077933:c1565231-1565172 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|