Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 1471370..1471677 | Replicon | chromosome |
| Accession | NZ_CP077932 | ||
| Organism | Staphylococcus aureus strain 194 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | KU515_RS07420 | Protein ID | WP_011447039.1 |
| Coordinates | 1471501..1471677 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 1471370..1471509 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU515_RS07380 (1466709) | 1466709..1466969 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| KU515_RS07385 (1467022) | 1467022..1467372 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| KU515_RS07390 (1468057) | 1468057..1468506 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| KU515_RS07395 (1468601) | 1468601..1468936 | - | 336 | Protein_1436 | SH3 domain-containing protein | - |
| KU515_RS07400 (1469586) | 1469586..1470077 | - | 492 | WP_000919350.1 | staphylokinase | - |
| KU515_RS07405 (1470268) | 1470268..1471023 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| KU515_RS07410 (1471035) | 1471035..1471289 | - | 255 | WP_000611512.1 | phage holin | - |
| KU515_RS07415 (1471341) | 1471341..1471448 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - (1471370) | 1471370..1471509 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1471370) | 1471370..1471509 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1471370) | 1471370..1471509 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1471370) | 1471370..1471509 | + | 140 | NuclAT_0 | - | Antitoxin |
| KU515_RS07420 (1471501) | 1471501..1471677 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| KU515_RS07425 (1471827) | 1471827..1472123 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| KU515_RS07430 (1472181) | 1472181..1472468 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| KU515_RS07435 (1472515) | 1472515..1472667 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| KU515_RS07440 (1472657) | 1472657..1476442 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 1467022..1505237 | 38215 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T208687 WP_011447039.1 NZ_CP077932:c1471677-1471501 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T208687 NZ_CP103710:184766-184873 [Escherichia coli O25b:H4-ST131]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 140 bp
>AT208687 NZ_CP077932:1471370-1471509 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
