Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 292282..292696 | Replicon | chromosome |
Accession | NZ_CP077932 | ||
Organism | Staphylococcus aureus strain 194 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | KU515_RS01475 | Protein ID | WP_158171471.1 |
Coordinates | 292282..292533 (+) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | KU515_RS01480 | Protein ID | WP_000028424.1 |
Coordinates | 292523..292696 (+) | Length | 58 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU515_RS01415 (287875) | 287875..288696 | + | 822 | WP_225798360.1 | phage replisome organizer N-terminal domain-containing protein | - |
KU515_RS01420 (288709) | 288709..289494 | + | 786 | WP_024273306.1 | ATP-binding protein | - |
KU515_RS01425 (289491) | 289491..289649 | + | 159 | WP_031929742.1 | hypothetical protein | - |
KU515_RS01430 (289662) | 289662..289883 | + | 222 | WP_001123695.1 | DUF3269 family protein | - |
KU515_RS01435 (289893) | 289893..290297 | + | 405 | WP_021758092.1 | DUF1064 domain-containing protein | - |
KU515_RS01440 (290302) | 290302..290487 | + | 186 | WP_001187244.1 | DUF3113 family protein | - |
KU515_RS01445 (290488) | 290488..290859 | + | 372 | WP_053005624.1 | SA1788 family PVL leukocidin-associated protein | - |
KU515_RS01450 (290860) | 290860..291108 | + | 249 | WP_160194614.1 | phi PVL orf 51-like protein | - |
KU515_RS01455 (291121) | 291121..291327 | + | 207 | WP_054192815.1 | hypothetical protein | - |
KU515_RS01460 (291330) | 291330..291737 | + | 408 | WP_176323847.1 | hypothetical protein | - |
KU515_RS01465 (291734) | 291734..291934 | + | 201 | WP_123157447.1 | hypothetical protein | - |
KU515_RS01470 (291924) | 291924..292289 | + | 366 | WP_225798359.1 | acetyltransferase | - |
KU515_RS01475 (292282) | 292282..292533 | + | 252 | WP_158171471.1 | DUF1024 family protein | Toxin |
KU515_RS01480 (292523) | 292523..292696 | + | 174 | WP_000028424.1 | hypothetical protein | Antitoxin |
KU515_RS01485 (292697) | 292697..292858 | + | 162 | WP_000889684.1 | hypothetical protein | - |
KU515_RS01490 (292873) | 292873..293400 | + | 528 | WP_054192935.1 | dUTPase | - |
KU515_RS01495 (293437) | 293437..293643 | + | 207 | WP_168751664.1 | DUF1381 domain-containing protein | - |
KU515_RS01500 (293640) | 293640..294026 | + | 387 | WP_000592207.1 | hypothetical protein | - |
KU515_RS01505 (294023) | 294023..294196 | + | 174 | WP_000595256.1 | transcriptional activator RinB | - |
KU515_RS01510 (294197) | 294197..294598 | + | 402 | WP_000286968.1 | hypothetical protein | - |
KU515_RS01515 (294952) | 294952..295446 | + | 495 | WP_000594088.1 | terminase small subunit | - |
KU515_RS01520 (295439) | 295439..296662 | + | 1224 | WP_001037578.1 | PBSX family phage terminase large subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sec / sell / vWbp | 275814..360017 | 84203 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 9463.35 Da Isoelectric Point: 3.6767
>T208683 WP_158171471.1 NZ_CP077932:292282-292533 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGLPNAMQDALKEDIDLDEAVGIMVSQVVYKYEEEQE
NEY
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGLPNAMQDALKEDIDLDEAVGIMVSQVVYKYEEEQE
NEY
Download Length: 252 bp
>T208683 NZ_CP103705:57404-57553 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 58 a.a. Molecular weight: 6468.29 Da Isoelectric Point: 4.2484
>AT208683 WP_000028424.1 NZ_CP077932:292523-292696 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE
Download Length: 174 bp
>AT208683 NZ_CP103705:c57360-57299 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|