Detailed information of TA system TA208683

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): higBA (relBE)/-
• Location: 292282..292696
• Replicon: chromosome
• Accession: NZ_CP077932
• Organism: Staphylococcus aureus strain 194

Toxin (Protein)

• Gene name: higB
• Uniprot ID: -
• Locus tag: KU515_RS01475
• Protein ID: WP_158171471.1
• Coordinates: 292282..292533 (+)
• Length: 84 a.a.

Antitoxin (Protein)

• Gene name: higA
• Uniprot ID: -
• Locus tag: KU515_RS01480
• Protein ID: WP_000028424.1
• Coordinates: 292523..292696 (+)
• Length: 58 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
KU515_RS01415	287875..288696	+	822	WP_225798360.1	phage replisome organizer N-terminal domain-containing protein	-
KU515_RS01420	288709..289494	+	786	WP_024273306.1	ATP-binding protein	-
KU515_RS01425	289491..289649	+	159	WP_031929742.1	hypothetical protein	-
KU515_RS01430	289662..289883	+	222	WP_001123695.1	DUF3269 family protein	-
KU515_RS01435	289893..290297	+	405	WP_021758092.1	DUF1064 domain-containing protein	-
KU515_RS01440	290302..290487	+	186	WP_001187244.1	DUF3113 family protein	-
KU515_RS01445	290488..290859	+	372	WP_053005624.1	SA1788 family PVL leukocidin-associated protein	-
KU515_RS01450	290860..291108	+	249	WP_160194614.1	phi PVL orf 51-like protein	-
KU515_RS01455	291121..291327	+	207	WP_054192815.1	hypothetical protein	-
KU515_RS01460	291330..291737	+	408	WP_176323847.1	hypothetical protein	-
KU515_RS01465	291734..291934	+	201	WP_123157447.1	hypothetical protein	-
KU515_RS01470	291924..292289	+	366	WP_225798359.1	acetyltransferase	-
KU515_RS01475	292282..292533	+	252	WP_158171471.1	DUF1024 family protein	Toxin
KU515_RS01480	292523..292696	+	174	WP_000028424.1	hypothetical protein	Antitoxin
KU515_RS01485	292697..292858	+	162	WP_000889684.1	hypothetical protein	-
KU515_RS01490	292873..293400	+	528	WP_054192935.1	dUTPase	-
KU515_RS01495	293437..293643	+	207	WP_168751664.1	DUF1381 domain-containing protein	-
KU515_RS01500	293640..294026	+	387	WP_000592207.1	hypothetical protein	-
KU515_RS01505	294023..294196	+	174	WP_000595256.1	transcriptional activator RinB	-
KU515_RS01510	294197..294598	+	402	WP_000286968.1	hypothetical protein	-
KU515_RS01515	294952..295446	+	495	WP_000594088.1	terminase small subunit	-
KU515_RS01520	295439..296662	+	1224	WP_001037578.1	PBSX family phage terminase large subunit	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	sec / sell / vWbp	275814..360017	84203

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Protein of unknown function DUF1024 (1-82)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 84 a.a.
• Molecular weight: 9463.35 Da
• Isoelectric Point: 3.6767

>T208683 WP_158171471.1 NZ_CP077932:292282-292533 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGLPNAMQDALKEDIDLDEAVGIMVSQVVYKYEEEQE
NEY

Nucleotide

• Length: 252 bp

>T208683 NZ_CP103705:57404-57553 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Protein

• Length: 58 a.a.
• Molecular weight: 6468.29 Da
• Isoelectric Point: 4.2484

>AT208683 WP_000028424.1 NZ_CP077932:292523-292696 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Nucleotide

• Length: 174 bp

>AT208683 NZ_CP103705:c57360-57299 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT