Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 984076..984375 | Replicon | chromosome |
Accession | NZ_CP077917 | ||
Organism | Staphylococcus aureus strain 280 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | KU509_RS05040 | Protein ID | WP_011447039.1 |
Coordinates | 984199..984375 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 984076..984131 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU509_RS05000 | 979407..979667 | + | 261 | WP_001791826.1 | hypothetical protein | - |
KU509_RS05005 | 979720..980070 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
KU509_RS05010 | 980755..981204 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
KU509_RS05015 | 981299..981634 | - | 336 | Protein_953 | SH3 domain-containing protein | - |
KU509_RS05020 | 982284..982775 | - | 492 | WP_000919350.1 | staphylokinase | - |
KU509_RS05025 | 982966..983721 | - | 756 | WP_064131634.1 | CHAP domain-containing protein | - |
KU509_RS05030 | 983733..983987 | - | 255 | WP_000611512.1 | phage holin | - |
KU509_RS05035 | 984039..984146 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 984068..984207 | + | 140 | NuclAT_0 | - | - |
- | 984068..984207 | + | 140 | NuclAT_0 | - | - |
- | 984068..984207 | + | 140 | NuclAT_0 | - | - |
- | 984068..984207 | + | 140 | NuclAT_0 | - | - |
- | 984076..984131 | + | 56 | - | - | Antitoxin |
KU509_RS05040 | 984199..984375 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
KU509_RS05045 | 984525..984821 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
KU509_RS05050 | 984879..985166 | - | 288 | WP_001040261.1 | hypothetical protein | - |
KU509_RS05055 | 985213..985365 | - | 153 | WP_001153681.1 | hypothetical protein | - |
KU509_RS05060 | 985355..989140 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak | 979720..1021243 | 41523 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T208552 WP_011447039.1 NZ_CP077917:c984375-984199 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T208552 NZ_CP103673:c4586748-4586575 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 56 bp
>AT208552 NZ_CP077917:984076-984131 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|