Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 2125944..2126250 | Replicon | chromosome |
Accession | NZ_CP077899 | ||
Organism | Staphylococcus aureus strain 324 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | KU505_RS10360 | Protein ID | WP_078159559.1 |
Coordinates | 2126074..2126250 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2125944..2126082 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KU505_RS10320 (2121285) | 2121285..2121545 | + | 261 | WP_001791826.1 | hypothetical protein | - |
KU505_RS10325 (2121598) | 2121598..2121948 | - | 351 | WP_225805877.1 | complement inhibitor SCIN-A | - |
KU505_RS10330 (2122631) | 2122631..2123080 | + | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
KU505_RS10335 (2123175) | 2123175..2123509 | - | 335 | Protein_2002 | SH3 domain-containing protein | - |
KU505_RS10340 (2124160) | 2124160..2124651 | - | 492 | WP_225805878.1 | staphylokinase domain-containing protein | - |
KU505_RS10345 (2124842) | 2124842..2125597 | - | 756 | WP_000861027.1 | CHAP domain-containing protein | - |
KU505_RS10350 (2125609) | 2125609..2125863 | - | 255 | WP_000611512.1 | phage holin | - |
KU505_RS10355 (2125915) | 2125915..2126021 | + | 107 | Protein_2006 | hypothetical protein | - |
- (2125944) | 2125944..2126082 | + | 139 | NuclAT_0 | - | Antitoxin |
- (2125944) | 2125944..2126082 | + | 139 | NuclAT_0 | - | Antitoxin |
- (2125944) | 2125944..2126082 | + | 139 | NuclAT_0 | - | Antitoxin |
- (2125944) | 2125944..2126082 | + | 139 | NuclAT_0 | - | Antitoxin |
KU505_RS10360 (2126074) | 2126074..2126250 | - | 177 | WP_078159559.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
KU505_RS10365 (2126393) | 2126393..2126767 | - | 375 | WP_060649626.1 | hypothetical protein | - |
KU505_RS10370 (2126801) | 2126801..2127085 | - | 285 | WP_000400415.1 | hypothetical protein | - |
KU505_RS10375 (2127129) | 2127129..2127296 | - | 168 | WP_000421095.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | sak / hlb / tsst-1 / groEL / hld | 2124087..2225522 | 101435 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6821.39 Da Isoelectric Point: 10.6777
>T208486 WP_078159559.1 NZ_CP077899:c2126250-2126074 [Staphylococcus aureus]
MDRWWLSEYKEVVPMAALLKSLERRRLMITISTMLQFGLFLIALIGIVIKLIELSNKK
MDRWWLSEYKEVVPMAALLKSLERRRLMITISTMLQFGLFLIALIGIVIKLIELSNKK
Download Length: 177 bp
>T208486 NZ_CP103657:2201334-2201437 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 139 bp
>AT208486 NZ_CP077899:2125944-2126082 [Staphylococcus aureus]
ATATATAGAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAAG
ATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAAG
ATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|