Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 1010733..1010959 | Replicon | chromosome |
| Accession | NZ_CP077899 | ||
| Organism | Staphylococcus aureus strain 324 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | - |
| Locus tag | KU505_RS04860 | Protein ID | WP_044122766.1 |
| Coordinates | 1010733..1010837 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 1010866..1010959 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KU505_RS04845 (1006970) | 1006970..1007344 | + | 375 | WP_000343402.1 | hypothetical protein | - |
| KU505_RS04850 (1007469) | 1007469..1009355 | + | 1887 | WP_001207581.1 | glucosaminidase domain-containing protein | - |
| KU505_RS04855 (1009798) | 1009798..1010571 | + | 774 | WP_000750404.1 | staphylococcal enterotoxin type A | - |
| KU505_RS04860 (1010733) | 1010733..1010837 | + | 105 | WP_044122766.1 | hypothetical protein | Toxin |
| - (1010866) | 1010866..1010959 | - | 94 | NuclAT_1 | - | Antitoxin |
| - (1010866) | 1010866..1010959 | - | 94 | NuclAT_1 | - | Antitoxin |
| - (1010866) | 1010866..1010959 | - | 94 | NuclAT_1 | - | Antitoxin |
| - (1010866) | 1010866..1010959 | - | 94 | NuclAT_1 | - | Antitoxin |
| KU505_RS04865 (1010893) | 1010893..1010988 | - | 96 | Protein_950 | hypothetical protein | - |
| KU505_RS04870 (1011040) | 1011040..1011294 | + | 255 | WP_000611512.1 | phage holin | - |
| KU505_RS04875 (1011306) | 1011306..1012061 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| KU505_RS04880 (1012287) | 1012287..1012415 | + | 129 | WP_000884149.1 | hypothetical protein | - |
| KU505_RS04885 (1012487) | 1012487..1012597 | + | 111 | WP_000139425.1 | hypothetical protein | - |
| KU505_RS04890 (1012599) | 1012599..1012784 | + | 186 | WP_001286805.1 | hypothetical protein | - |
| KU505_RS04895 (1013215) | 1013215..1013394 | + | 180 | WP_000201921.1 | hypothetical protein | - |
| KU505_RS04900 (1013416) | 1013416..1013943 | + | 528 | WP_000455171.1 | DUF4065 domain-containing protein | - |
| KU505_RS04905 (1013933) | 1013933..1014331 | + | 399 | WP_000557463.1 | hypothetical protein | - |
| KU505_RS04910 (1014776) | 1014776..1014915 | + | 140 | Protein_959 | hypothetical protein | - |
| KU505_RS04915 (1014921) | 1014921..1015235 | - | 315 | WP_000274031.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sea | 971622..1014331 | 42709 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3932.77 Da Isoelectric Point: 5.5724
>T208479 WP_044122766.1 NZ_CP077899:1010733-1010837 [Staphylococcus aureus]
MLLLERNSMSDFEMLMVVLTIIGLVLISNQDHKK
MLLLERNSMSDFEMLMVVLTIIGLVLISNQDHKK
Download Length: 105 bp
>T208479 NZ_CP103657:224687-224794 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 94 bp
>AT208479 NZ_CP077899:c1010959-1010866 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTTTTCATAGAAAAA
TTATAAAAATAACC
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTTTTCATAGAAAAA
TTATAAAAATAACC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|